3Q2T: CFIm68 RRM/CFIm25/RNA complex

Crystal Structure of CFIm68 RRM/CFIm25/RNA complex. Determined by X-ray diffraction at 3.06 Å resolution. Released 16 Feb 2011.

Method: X-ray diffraction
Resolution: 3.06 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,035
Mol. weight: 100.13 kDa
Released: 16 Feb 2011

Explore 3Q2T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q2T contains 25 α-helices and 39 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	26-30	5
β-strand	36-39	4	1
β-strand	41	1	2
α-helix	42-44	3
β-strand	45-50	6	3
α-helix	60-73	14
β-strand	77-84	8	4
β-strand	85-87	3	2
β-strand	92-99	8	2
β-strand	103-105	3	2
β-strand	108-110	3	4
α-helix	111-112	2
α-helix	117-129	13
β-strand	140-150	11	4
β-strand	158	1	4
β-strand	170-178	9	4
β-strand	183-188	6	3
β-strand	192-197	6	2
α-helix	198-201	4
α-helix	205-208	4
α-helix	210-220	11
β-strand	223-226	4	1

Chain B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	22-28	7
β-strand	36-39	4	5
β-strand	41	1	6
α-helix	42-44	3
β-strand	45-50	6	7
α-helix	60-74	15
β-strand	77-84	8	8
β-strand	85-88	4	6
β-strand	91-98	8	6
β-strand	104-105	2	6
β-strand	108-110	3	8
α-helix	111-112	2
α-helix	117-128	12
β-strand	140-150	11	8
β-strand	158	1	8
β-strand	170-178	9	8
β-strand	183-188	6	7
β-strand	192-197	6	6
α-helix	198-201	4
α-helix	205-208	4
α-helix	210-213	4
α-helix	215-220	6
β-strand	223-226	4	5

Chain C: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	82-86	5	9
α-helix	94-101	8
α-helix	102-104	3
β-strand	109-110	2	9
β-strand	114-116	3	9
β-strand	123-131	9	9
α-helix	136-143	8
β-strand	149	1	10
β-strand	152	1	10
β-strand	155-158	4	9
α-helix	161-171	11

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	82-86	5	11
α-helix	94-104	11
β-strand	111-116	6	11
β-strand	123-130	8	11
α-helix	135-143	9
α-helix	144-146	3
β-strand	157-158	2	11
α-helix	164-171	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cleavage and polyadenylation specificity factor subunit 5	A, B	protein	207	Homo sapiens	O43809 (AlphaFold model)
Cleavage and polyadenylation specificity factor subunit 6	C, D	protein	229	Homo sapiens	Q16630 (AlphaFold model)
RNA	E, F	RNA	5

Sequence of entity 1 (A, B), FASTA

>3Q2T_1 Cleavage and polyadenylation specificity factor subunit 5 (chains A, B)
GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTV
EGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFE
LYDNAPGYGPIISSLPQLLSRFNFIYN

Sequence of entity 2 (C, D), FASTA

>3Q2T_2 Cleavage and polyadenylation specificity factor subunit 6 (chains C, D)
DVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNV
VYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVG
SEASSKKLMDLLPKRELHGQNPVVTPVNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGS
SRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTHHHHHH

Sequence of entity 3 (E, F), FASTA

>3Q2T_3 RNA (chains E, F)
UUGUA

Primary citation

Crystal Structure of a Human Cleavage Factor CFI(m)25/CFI(m)68/RNA Complex Provides an Insight into Poly(A) Site Recognition and RNA Looping. Yang, Q., Coseno, M., Gilmartin, G.M. et al. Structure (2011) 19:368-377. DOI 10.1016/j.str.2010.12.021 · PubMed

Other PDB entries of the same protein (UniProt O43809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5R4Q 1.49 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4R 1.5 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R67 1.52 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4S 1.61 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4T 1.68 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4P 1.78 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
3BHO 1.8 Å, Crystal Structure of the 25kDa Subunit of Human Cleavage factor Im with Ap4A
5R64 1.84 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
3BAP 1.85 Å, Crystal Structure of the 25 kDa Subunit of Human Cleavage Factor Im
2CL3 1.9 Å, Crystal structure of human Cleavage and Polyadenylation Specificity Factor 5 (CPSF5)
3N9U 1.92 Å, Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM…
5R4U 1.92 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…

Browse structure collections

About this viewer

MolViewer shows 3Q2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.