3QAZ: IL-2 mutant D10 ternary complex

IL-2 mutant D10 ternary complex. Determined by X-ray diffraction at 3.8 Å resolution. Released 11 Apr 2012.

Method: X-ray diffraction
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 36
Atoms: 51,562
Mol. weight: 791.56 kDa
Ligands: NAG
Released: 11 Apr 2012

Explore 3QAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QAZ contains 220 α-helices and 450 β-strands across 36 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
β-strand	39-43	5	2
β-strand	47-51	5	2
α-helix	54-56	3
β-strand	64-69	6	3
β-strand	78	1	3
β-strand	82-85	4	2
β-strand	90-95	6	2
α-helix	97-99	3
α-helix	105	1
β-strand	106-111	6	3
β-strand	119-124	6	3
α-helix	126-128	3
β-strand	130-131	2	2
α-helix	132-135	4
β-strand	136-142	7	4
β-strand	148-153	6	4
β-strand	161-169	9	5
β-strand	176-180	5	5
β-strand	186-188	3	4
β-strand	197-205	9	5
α-helix	217-219	3
β-strand	222-223	2	5

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-28	22
α-helix	36-39	4
β-strand	44-47	4	1
α-helix	53-56	4
α-helix	57-60	4
α-helix	63-70	8
α-helix	82-95	14
β-strand	107-112	6	1
α-helix	114-131	18

Chain b: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-28	22
α-helix	36-39	4
β-strand	44	1	10
α-helix	45-46	2
β-strand	47	1	11
α-helix	53-56	4
α-helix	57-61	5
α-helix	63-70	8
α-helix	82-94	13
β-strand	107	1	11
β-strand	112	1	10
α-helix	114-130	17

Chain B: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	6
β-strand	17-23	7	6
β-strand	33-39	7	7
β-strand	46-49	4	7
β-strand	51-52	2	6
β-strand	57-63	7	6
β-strand	78-86	9	7
β-strand	89-98	10	7
α-helix	100-102	3
β-strand	104	1	6
α-helix	106-109	4
β-strand	110-117	8	8
β-strand	122-127	6	8
α-helix	133-135	3
β-strand	139-146	8	9
α-helix	156-157	2
β-strand	158-160	3	9
β-strand	166-169	4	8
β-strand	177-186	10	9
α-helix	194-200	7
β-strand	201-204	4	9

Chain c: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	16
β-strand	17-23	7	16
β-strand	33-39	7	17
β-strand	46-49	4	17
β-strand	51-52	2	16
β-strand	57-63	7	16
β-strand	78-86	9	17
β-strand	89-98	10	17
α-helix	100-102	3
β-strand	104	1	16
α-helix	106-109	4
β-strand	110-117	8	18
β-strand	122-127	6	18
β-strand	140-146	7	19
β-strand	157-160	4	19
β-strand	166-168	3	18
β-strand	177-178	2	20
β-strand	179-185	7	19
α-helix	194-200	7
β-strand	203-204	2	20

Chain C: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	35-38	4
β-strand	39-43	5	12
β-strand	47-51	5	12
β-strand	64-69	6	13
α-helix	77	1
β-strand	78-79	2	13
α-helix	80	1
β-strand	83-85	3	12
β-strand	90-96	7	12
α-helix	97-99	3
β-strand	106-111	6	13
β-strand	119-124	6	13
α-helix	126-128	3
β-strand	130-131	2	12
α-helix	132-135	4
β-strand	136-144	9	14
β-strand	147-153	7	14
β-strand	161-169	9	15
β-strand	176-180	5	15
β-strand	185-188	4	14
β-strand	197-205	9	15
α-helix	217-221	5
β-strand	222-223	2	15

Chain d: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
β-strand	39-43	5	22
β-strand	47-51	5	22
β-strand	64-68	5	23
β-strand	78-79	2	23
β-strand	82-85	4	22
β-strand	90-95	6	22
β-strand	106-111	6	23
β-strand	119-124	6	23
α-helix	126-129	4
β-strand	130-131	2	22
α-helix	132-135	4
β-strand	136-139	4	24
β-strand	142	1	25
β-strand	148-150	3	25
β-strand	151-153	3	24
β-strand	161-167	7	26
β-strand	176-180	5	26
β-strand	186-188	3	25
β-strand	198-205	8	26
α-helix	215-219	5
β-strand	222-223	2	26

Chain D: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-28	19
α-helix	36-41	6
β-strand	44-47	4	21
α-helix	53-56	4
α-helix	57-60	4
α-helix	63-70	8
α-helix	75-77	3
α-helix	82-94	13
β-strand	107-112	6	21
α-helix	114-130	17

28 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-2	A, D, G, J, M, P, S, V, Y, b, e, h	protein	136	Homo sapiens	P60568 (AlphaFold model)
Interleukin-2 receptor subunit beta	B, E, H, K, N, Q, T, W, Z, c, f, i	protein	217	Homo sapiens	P14784 (AlphaFold model)
Cytokine receptor common subunit gamma	C, F, I, L, O, R, U, X, a, d, g, j	protein	202	Homo sapiens	P31785 (AlphaFold model)

Sequence of entity 1 (A, D, G, J, M, P, S, V, Y, b, e, h), FASTA

>3QAZ_1 Interleukin-2 (chains A, D, G, J, M, P, S, V, Y, b, e, h)
ADPAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQ
CLEEELKPLEEVLNLAHSKNFHFDPRDVVSNINVFVLELKGSETTFMCEYADETATIVEF
LNRWITFCQSIISTLT

Sequence of entity 2 (B, E, H, K, N, Q, T, W, Z, c, f, i), FASTA

>3QAZ_2 Interleukin-2 receptor subunit beta (chains B, E, H, K, N, Q, T, W, Z, c, f, i)
ADPAVQGTSQFTCFYNSRAQISCVWSQDGALQDTSCQVHAWPDRRRWQQTCELLPVSQAS
WACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHV
ETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQ
YEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT

Sequence of entity 3 (C, F, I, L, O, R, U, X, a, d, g, j), FASTA

>3QAZ_3 Cytokine receptor common subunit gamma (chains C, F, I, L, O, R, U, X, a, d, g, j)
ADPPLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEIT
SGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLEL
NWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCG
SAQHWSEWSHPIHWGSNTSKEN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	54

Primary citation

Exploiting a natural conformational switch to engineer an interleukin-2 'superkine'. Levin, A.M., Bates, D.L., Ring, A.M. et al. Nature (2012) 484:529-533. DOI 10.1038/nature10975 · PubMed

Other PDB entries of the same protein (UniProt P60568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SOZ 1.64 Å, Structure of the complex formed by human interleukin-2 and scFv 602
8SOW 1.71 Å, Structure of the complex formed by human interleukin-2 and scFv F10
7M2G 1.79 Å, INTERLEUKIN-2 (human) mutant P65K, C125S
4NEJ 1.92 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
4NEM 1.93 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
1M48 1.95 Å, Crystal Structure of Human IL-2 Complexed with (R)-N-[2-[1-(Aminoiminomethyl)-3-piperidin…
5LQB 1.95 Å, Complex structure of human IL2 mutant, Proleukin, with Fab fragment of NARA1 antibody
1M47 1.99 Å, Crystal Structure of Human Interleukin-2
1M49 2.0 Å, Crystal Structure of Human Interleukin-2 Complexed with SP-1985
1M4B 2.15 Å, Crystal Structure of Human Interleukin-2 K43C Covalently Modified at C43 with…
1M4A 2.18 Å, Crystal Structure of Human Interleukin-2 Y31C Covalently Modified at C31 with…
1NBP 2.2 Å, Crystal Structure Of Human Interleukin-2 Y31C Covalently Modified At C31 With…

Browse structure collections

About this viewer

MolViewer shows 3QAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.