3QCA: FAF1 UBX Domain

Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The Conserved FcisP Touch-Turn Motif of UBX Domain Suffering Conformational Change. Determined by X-ray diffraction at 2.9 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,577
Mol. weight: 39.34 kDa
Released: 25 May 2011

Explore 3QCA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QCA contains 12 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	1
α-helix	580	1
β-strand	585-591	7	1
β-strand	595	1	2
α-helix	596-605	10
α-helix	610-612	3
β-strand	613-617	5	1
β-strand	622-623	2	1
α-helix	624-626	3
β-strand	632	1	2
β-strand	641-648	8	1

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	3
α-helix	580	1
β-strand	585-591	7	3
β-strand	595	1	4
α-helix	596-605	10
β-strand	613-617	5	3
β-strand	622-623	2	3
β-strand	632	1	4
β-strand	641-648	8	3

Chain C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	5
α-helix	580	1
β-strand	585-591	7	5
β-strand	595	1	6
α-helix	596-605	10
β-strand	613-616	4	5
β-strand	623	1	5
α-helix	624-626	3
β-strand	632	1	6
β-strand	641-648	8	5

Chain D: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	573-579	7	7
α-helix	580	1
β-strand	585-591	7	7
β-strand	595	1	8
α-helix	596-605	10
β-strand	613-617	5	7
β-strand	622-623	2	7
α-helix	624-626	3
β-strand	632	1	8
β-strand	641-648	8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAS-associated factor 1	A, B, C, D	protein	84	Homo sapiens	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3QCA_1 FAS-associated factor 1 (chains A, B, C, D)
GSEFEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQ
LDPNKSLLEVKLFPQETLFLEAKE

Primary citation

Crystal structure of human FAF1 UBX domain reveals a novel FcisP touch-turn motif in p97/VCP-binding region. Kang, W., Yang, J.K. Biochem Biophys Res Commun (2011) 407:531-534. DOI 10.1016/j.bbrc.2011.03.052 · PubMed

Other PDB entries of the same protein (UniProt Q9UNN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FGN 1.2 Å, The crystal structure of the FAF1 UBL1
3QX1 1.6 Å, Crystal structure of FAF1 UBX domain
3E21 1.73 Å, Crystal structure of FAF-1 UBA Domain
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
3QC8 2.2 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
7FGM 2.2 Å, The complex crystals structure of the FAF1 UBL1_L-Hsp70 NBD with ADP and phosphate
3R3M 3.0 Å, Crystal structure of the FAF1 UBX domain
8KG2 3.1 Å, Crystal structure of p97-N/D1 hexamer in complex with FAF1-UBX domain
9YW2 3.27 Å, Complex structure of human p97 bound to Faf1 and Ufd1 (NTD focused)
11TA 3.58 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (motor focused)
11VE 3.85 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (State1)

Browse structure collections

About this viewer

MolViewer shows 3QCA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.