7FGN: FAF1 UBL1

The crystal structure of the FAF1 UBL1. Determined by X-ray diffraction at 1.2 Å resolution. Released 27 Jul 2022.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 718
Mol. weight: 8.91 kDa
Released: 27 Jul 2022

Explore 7FGN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FGN contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	100-107	8	1
β-strand	110-117	8	1
β-strand	121	1	2
α-helix	122-133	12
α-helix	137-139	3
β-strand	141-143	3	1
β-strand	155	1	2
α-helix	156-159	4
β-strand	164-170	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAS-associated factor 1	A	protein	78	Homo sapiens	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7FGN_1 FAS-associated factor 1 (chains A)
GSHMLDFRVEYRDRNVDVVLEDTCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVL
KSLHLPKNNSLYVLTPDL

Primary citation

The complex of Fas-associated factor 1 with Hsp70 stabilizes the adherens junction integrity by suppressing RhoA activation. Song, S., Park, J.K., Shin, S.C. et al. J Mol Cell Biol (2022) 14. DOI 10.1093/jmcb/mjac037

Other PDB entries of the same protein (UniProt Q9UNN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QX1 1.6 Å, Crystal structure of FAF1 UBX domain
3E21 1.73 Å, Crystal structure of FAF-1 UBA Domain
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
3QC8 2.2 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
7FGM 2.2 Å, The complex crystals structure of the FAF1 UBL1_L-Hsp70 NBD with ADP and phosphate
3QCA 2.9 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
3R3M 3.0 Å, Crystal structure of the FAF1 UBX domain
8KG2 3.1 Å, Crystal structure of p97-N/D1 hexamer in complex with FAF1-UBX domain
9YW2 3.27 Å, Complex structure of human p97 bound to Faf1 and Ufd1 (NTD focused)
11TA 3.58 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (motor focused)
11VE 3.85 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (State1)

Browse structure collections

About this viewer

MolViewer shows 7FGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.