Crystal structure of FAF1 UBX domain. Determined by X-ray diffraction at 1.6 Å resolution. Released 9 May 2012.
Explore 3QX1 in 3D Show helices and sheets RCSB PDB PDBe
3QX1 contains 6 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 573-579 | 7 | 1 |
| β-strand | 585-591 | 7 | 1 |
| β-strand | 595 | 1 | 2 |
| α-helix | 596-605 | 10 | |
| β-strand | 613-616 | 4 | 1 |
| α-helix | 617 | 1 | |
| α-helix | 621 | 1 | |
| β-strand | 623 | 1 | 1 |
| α-helix | 624-626 | 3 | |
| β-strand | 632 | 1 | 2 |
| β-strand | 641-648 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 573-579 | 7 | 1 |
| β-strand | 585-591 | 7 | 1 |
| β-strand | 595 | 1 | 3 |
| α-helix | 596-605 | 10 | |
| β-strand | 613-617 | 5 | 1 |
| β-strand | 622-623 | 2 | 1 |
| α-helix | 624-626 | 3 | |
| β-strand | 632 | 1 | 3 |
| β-strand | 641-648 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FAS-associated factor 1 | A, B | protein | 84 | Homo sapiens | Q9UNN5 (AlphaFold model) |
>3QX1_1 FAS-associated factor 1 (chains A, B) GSHMEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQ LDPNKSLLEVKLFPQETLFLEAKE
Dissection of the interaction between FAF1 UBX and p97. Park, J.K., Jeon, H., Lee, J.J. et al. To be published.
Other PDB entries of the same protein (UniProt Q9UNN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3QX1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.