3QGL: PDZ domain of sorting nexin 27

Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) in complex with the ESESKV peptide corresponding to the C-terminal tail of GIRK3. Determined by X-ray diffraction at 3.31 Å resolution. Released 16 Mar 2011.

Method: X-ray diffraction
Resolution: 3.31 Å
Organism: Rattus norvegicus
Chains: 10
Atoms: 3,820
Mol. weight: 56.24 kDa
Released: 16 Mar 2011

Explore 3QGL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QGL contains 10 α-helices and 55 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and E: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	40-45	6	1
β-strand	47	1	2
β-strand	50	1	2
β-strand	53-57	5	1
β-strand	66-68	3	3
β-strand	71-73	3	3
β-strand	77-82	6	1
α-helix	88-91	4
β-strand	98-102	5	1
β-strand	105-106	2	1
α-helix	112-120	9
β-strand	125-131	7	1

Chains C and D: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	40-45	6	4
β-strand	47	1	6
β-strand	50	1	6
β-strand	53-57	5	4
β-strand	66-68	3	7
β-strand	71-73	3	7
β-strand	77-82	6	4
α-helix	88-91	4
β-strand	98-102	5	4
β-strand	105-106	2	4
α-helix	112-121	10
β-strand	125-131	7	4

Chains F, G, H, I and J: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	202-205	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27	A, B, C, D, E	protein	101	Rattus norvegicus	Q8K4V4 (AlphaFold model)
G protein-activated inward rectifier potassium channel 3	F, G, H, I, J	protein	6	Rattus norvegicus	Q63511 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>3QGL_1 Sorting nexin-27 (chains A, B, C, D, E)
GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG
VRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV

Sequence of entity 2 (F, G, H, I, J), FASTA

>3QGL_2 G protein-activated inward rectifier potassium channel 3 (chains F, G, H, I, J)
ESESKV

Primary citation

Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27. Balana, B., Maslennikov, I., Kwiatkowski, W. et al. Proc Natl Acad Sci U S A (2011) 108:5831-5836. DOI 10.1073/pnas.1018645108 · PubMed

Other PDB entries of the same protein (UniProt Q8K4V4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
5ELQ 1.1 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal DGKzeta PDZ binding…
5EMA 1.32 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal LRRC3B…
5EM9 1.6 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal…
3QE1 1.68 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the C-terminal…
3QDO 1.88 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the Gly-Gly linker…
4P2A 2.7 Å, Structure of mouse VPS26A bound to rat SNX27 PDZ domain

Browse structure collections

About this viewer

MolViewer shows 3QGL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.