Structure of p63 DNA Binding Domain in Complex with a 22 Base Pair A/T Rich Response Element Containing 2 Base Pair Spacer Between Half Sites. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 Apr 2011.
Explore 3QYN in 3D Show helices and sheets RCSB PDB PDBe
3QYN contains 17 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 132 | 1 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 139-141 | 3 | 2 |
| β-strand | 153-156 | 4 | 1 |
| β-strand | 161-164 | 4 | 1 |
| β-strand | 170-175 | 6 | 2 |
| β-strand | 185-192 | 8 | 1 |
| β-strand | 203 | 1 | 3 |
| α-helix | 206-210 | 5 | |
| β-strand | 224 | 1 | 3 |
| β-strand | 226-229 | 4 | 2 |
| β-strand | 235-238 | 4 | 1 |
| β-strand | 245-250 | 6 | 1 |
| α-helix | 253-255 | 3 | |
| β-strand | 261-267 | 7 | 2 |
| β-strand | 282-289 | 8 | 1 |
| β-strand | 295-304 | 10 | 1 |
| α-helix | 309-316 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 132 | 1 | 4 |
| β-strand | 139-141 | 3 | 5 |
| β-strand | 153-156 | 4 | 4 |
| β-strand | 161-164 | 4 | 4 |
| β-strand | 169-175 | 7 | 5 |
| β-strand | 185-192 | 8 | 4 |
| α-helix | 201-202 | 2 | |
| α-helix | 206-210 | 5 | |
| β-strand | 226-228 | 3 | 5 |
| β-strand | 235-238 | 4 | 4 |
| β-strand | 245-250 | 6 | 4 |
| α-helix | 253-255 | 3 | |
| β-strand | 261-267 | 7 | 5 |
| β-strand | 282-289 | 8 | 4 |
| β-strand | 295-305 | 11 | 4 |
| α-helix | 309-320 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 126-128 | 3 | |
| β-strand | 132 | 1 | 6 |
| β-strand | 139-141 | 3 | 7 |
| β-strand | 153-156 | 4 | 6 |
| β-strand | 161-164 | 4 | 6 |
| β-strand | 169-175 | 7 | 7 |
| β-strand | 185-192 | 8 | 6 |
| α-helix | 201-202 | 2 | |
| α-helix | 206-210 | 5 | |
| β-strand | 226-228 | 3 | 7 |
| β-strand | 235-238 | 4 | 6 |
| β-strand | 245-250 | 6 | 6 |
| α-helix | 253-255 | 3 | |
| β-strand | 261-267 | 7 | 7 |
| β-strand | 282-289 | 8 | 6 |
| β-strand | 295-305 | 11 | 6 |
| α-helix | 309-319 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 132 | 1 | 8 |
| β-strand | 139-141 | 3 | 9 |
| β-strand | 153-156 | 4 | 8 |
| β-strand | 161-164 | 4 | 8 |
| β-strand | 169-175 | 7 | 9 |
| β-strand | 185-192 | 8 | 8 |
| α-helix | 201-202 | 2 | |
| α-helix | 206-210 | 5 | |
| β-strand | 226-228 | 3 | 9 |
| β-strand | 235-238 | 4 | 8 |
| β-strand | 245-250 | 6 | 8 |
| α-helix | 253-255 | 3 | |
| β-strand | 261-267 | 7 | 9 |
| β-strand | 282-289 | 8 | 8 |
| β-strand | 295-305 | 11 | 8 |
| α-helix | 309-319 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor protein 63 | A, B, C, D | protein | 203 | Homo sapiens | Q9H3D4 (AlphaFold model) |
| 5'-d(*ap*ap*ap*cp*ap*tp*gp*tp*tp*tp*tp*ap*ap*ap*ap*cp*ap*tp*gp*tp*tp*t)-3' | E, F | DNA | 22 |
>3QYN_1 Tumor protein 63 (chains A, B, C, D) GSHMASPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPP PQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDP ITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC FEARICACPGRDRKADEDSIRKQ
>3QYN_2 5'-D(*AP*AP*AP*CP*AP*TP*GP*TP*TP*TP*TP*AP*AP*AP*AP*CP*AP*TP*GP*TP*TP*T)-3' (chains E, F) AAACATGTTTTAAAACATGTTT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Structures of p63 DNA binding domain in complexes with half-site and with spacer-containing full response elements. Chen, C., Gorlatova, N., Kelman, Z. et al. Proc Natl Acad Sci U S A (2011) 108:6456-6461. DOI 10.1073/pnas.1013657108 · PubMed
Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3QYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.