3QZT: BPTF bromo

Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form II. Determined by X-ray diffraction at 1.5 Å resolution. Released 1 Jun 2011.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Homo sapiens, Xenopus laevis
Chains: 2
Atoms: 1,143
Mol. weight: 14.72 kDa
Released: 1 Jun 2011

Explore 3QZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QZT contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	67-70	4
α-helix	71-86	16
α-helix	91-93	3
α-helix	96-98	3
α-helix	99-101	3
α-helix	105-108	4
α-helix	115-123	9
α-helix	130-147	18
α-helix	153-170	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleosome-remodeling factor subunit BPTF	A	protein	115	Homo sapiens	Q12830
Histone H4	B	protein	10	Xenopus laevis	P62805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QZT_1 Nucleosome-remodeling factor subunit BPTF (chains A)
GPLGSVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATME
ERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA

Sequence of entity 2 (B), FASTA

>3QZT_2 Histone H4 (chains B)
KGGAKRHRKV

Primary citation

Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions. Ruthenburg, A.J., Li, H., Milne, T.A. et al. Cell (2011) 145:692-706. DOI 10.1016/j.cell.2011.03.053 · PubMed

Other PDB entries of the same protein (UniProt Q12830), best resolution first:

8AG2 1.02 Å, Crystal structure of the BPTF bromodomain in complex with BI-7190
5R4O 1.05 Å, PanDDA analysis group deposition of ground-state model of BROMODOMAIN OF HUMAN…
5R4M 1.11 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4L 1.13 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4K 1.17 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4H 1.18 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
7K6S 1.23 Å, Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing…
5R4G 1.25 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4I 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4N 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
9ZUK 1.35 Å, Crystal structure of BPTF bromodomain bound to BZ1
5R4J 1.39 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…

Browse structure collections

About this viewer

MolViewer shows 3QZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.