3R84: Mediator head subcomplex Med11/22

Name: PDB 3R84: Structure of the Mediator head subcomplex Med11/22
Published: 2011-04-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of the Mediator head subcomplex Med11/22. Determined by X-ray diffraction at 2.05 Å resolution. Released 27 Apr 2011.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Saccharomyces cerevisiae
Chains: 24
Atoms: 16,482
Mol. weight: 248.59 kDa
Released: 27 Apr 2011

Explore 3R84 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R84 contains 71 α-helices and 39 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, M, Q and S: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-38	34
α-helix	42-44	3
α-helix	45-75	31
β-strand	77	1	1
β-strand	81	1	1

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-25	22
β-strand	27	1	2
α-helix	42-48	7
α-helix	50-86	37
β-strand	87	1	1

Chains D, H, J, L and N: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-25	23
β-strand	27	1	4
α-helix	43-48	6
α-helix	50-86	37
β-strand	87	1	3

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-38	34
α-helix	42-44	3
α-helix	45-75	31

Chain F: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	4-25	22
β-strand	27	1	2
α-helix	43-48	6
α-helix	50-85	36

Chains G, I and K: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-38	34
α-helix	42-44	3
α-helix	45-76	32
β-strand	77	1	5
β-strand	81	1	5

Chain O: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-38	34
α-helix	42-44	3
α-helix	45-76	32

Chains P and X: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	3-25	23
β-strand	27	1	11
α-helix	43-48	6
α-helix	50-84	35

5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 11	A, C, E, G, I, K, M, O, Q, S, U, W	protein	86	Saccharomyces cerevisiae	Q99278 (AlphaFold model)
Mediator of RNA polymerase II transcription subunit 22	B, D, F, H, J, L, N, P, R, T, V, X	protein	92	Saccharomyces cerevisiae	P32570 (AlphaFold model)

Sequence of entity 1 (A, C, E, G, I, K, M, O, Q, S, U, W), FASTA

>3R84_1 Mediator of RNA polymerase II transcription subunit 11 (chains A, C, E, G, I, K, M, O, Q, S, U, W)
GYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKST
TQLRKEIQLLDENVGTRLLPINVNKK

Sequence of entity 2 (B, D, F, H, J, L, N, P, R, T, V, X), FASTA

>3R84_2 Mediator of RNA polymerase II transcription subunit 22 (chains B, D, F, H, J, L, N, P, R, T, V, X)
GSHMSNQALYEKLEQTRTILSVKLAELINITTIADRNDDDEGSFAQENSELAVATTSVMM
VNNQTMQLIKNVQDLLILTRSIKEKWLLNQIP

Primary citation

Mediator head subcomplex Med11/22 contains a common helix bundle building block with a specific function in transcription initiation complex stabilization. Seizl, M., Lariviere, L., Pfaffeneder, T. et al. Nucleic Acids Res (2011) 39:6291-6304. DOI 10.1093/nar/gkr229 · PubMed

Other PDB entries of the same protein (UniProt Q99278 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4H62 3.0 Å, Structure of the Saccharomyces cerevisiae Mediator subcomplex Med17C/Med11C/Med22C
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
9PC8 3.4 Å, Core Mediator of PIC-Med-SWI/SNF
8CEO 3.6 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator and the…
4GWP 4.2 Å, Structure of the Mediator Head Module from S. cerevisiae
3RJ1 4.3 Å, Architecture of the Mediator Head module
7UIG 4.3 Å, Mediator-PIC Early (Mediator A)
4GWQ 4.5 Å, Structure of the Mediator Head Module from S. cerevisiae in complex with the…
7UIF 4.6 Å, Mediator-PIC Early (Core B)
5OQM 5.8 Å, Structure of yeast transcription pre-initiation complex with tfiih and core mediator

Browse structure collections

About this viewer

MolViewer shows 3R84 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.