3R9M: Brox Bro1 domain

Crystal structure of the Brox Bro1 domain. Determined by X-ray diffraction at 1.95 Å resolution. Released 14 Sept 2011.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,558
Mol. weight: 43.46 kDa
Released: 14 Sept 2011

Explore 3R9M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R9M contains 22 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	-2-2	3
α-helix	8-11	4
β-strand	13	1	1
α-helix	21-23	3
β-strand	24	1	2
α-helix	27-46	20
α-helix	54-68	15
α-helix	69-71	3
β-strand	73	1	3
β-strand	81	1	3
β-strand	90-92	3	1
β-strand	102-104	3	1
α-helix	107-130	24
α-helix	137-156	20
α-helix	157-161	5
α-helix	162-164	3
α-helix	168-170	3
α-helix	177-201	25
α-helix	206-227	22
α-helix	232-263	32
α-helix	267-292	26
α-helix	303-305	3
α-helix	307-326	20
α-helix	327-331	5
α-helix	339-340	2
α-helix	353-355	3
α-helix	358-362	5
α-helix	367-371	5
β-strand	373	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRO1 domain-containing protein BROX	A	protein	376	Homo sapiens	Q5VW32 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3R9M_1 BRO1 domain-containing protein BROX (chains A)
GVDTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMK
NAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTLQGQVPSAQQDAVFELISMGFNV
ALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKLITPAEKGRDLESR
LIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKW
RKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPG
PTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEF
PPTSVQWTPETLAAFD

Primary citation

The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release. Sette, P., Mu, R., Dussupt, V. et al. Structure (2011) 19:1485-1495. DOI 10.1016/j.str.2011.07.016 · PubMed

Other PDB entries of the same protein (UniProt Q5VW32 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZXP 2.5 Å, Structural and Functional Analyses of the Bro1 Domain Protein BROX
3UM2 2.59 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3ULY 2.6 Å, Crystal Structure of BROX Bro1 Domain in Complex with the C-Terminal Tails of CHMP5
3UM1 2.71 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3UM0 3.1 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3UM3 3.8 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP4B

Browse structure collections

About this viewer

MolViewer shows 3R9M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.