3UM0: Brox Bro1 domain

Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5. Determined by X-ray diffraction at 3.1 Å resolution. Released 18 Apr 2012.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,268
Mol. weight: 48.63 kDa
Released: 18 Apr 2012

Explore 3UM0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UM0 contains 21 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	13	1	1
β-strand	24	1	2
α-helix	27-48	22
α-helix	54-68	15
α-helix	69-71	3
β-strand	73	1	3
β-strand	81	1	3
β-strand	90-93	4	1
β-strand	101-104	4	1
α-helix	107-129	23
α-helix	137-156	20
α-helix	157-161	5
α-helix	162-164	3
α-helix	168-170	3
α-helix	177-201	25
α-helix	206-227	22
α-helix	232-262	31
α-helix	268-291	24
α-helix	299-301	3
α-helix	308-323	16
α-helix	339-341	3
α-helix	358-362	5
α-helix	367-371	5
β-strand	373	1	2
α-helix	375-377	3
α-helix	388	1
β-strand	389	1	1
α-helix	390	1

Chain B: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201	1	4
β-strand	207	1	4
β-strand	208	1	5
β-strand	214	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRO1 domain-containing protein BROX	A	protein	410	Homo sapiens	Q5VW32 (AlphaFold model)
Charged multivesicular body protein 5	B	protein	20	Homo sapiens	Q9NZZ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UM0_1 BRO1 domain-containing protein BROX (chains A)
THWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNPEMMKNAA
DSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTLQGQVPSAQQDAVFELISMGFNVALW
YTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKLITPAEKGRDLESRLIE
AYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAYSAKWRKY
LHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGETKGPGPTV
KPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPT
SVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS

Sequence of entity 2 (B), FASTA

>3UM0_2 Charged multivesicular body protein 5 (chains B)
TKNKDGVLVDEFGLPQIPAS

Primary citation

Two Distinct Binding Modes Define the Interaction of Brox with the C-Terminal Tails of CHMP5 and CHMP4B. Mu, R., Dussupt, V., Jiang, J. et al. Structure (2012) 20:887-898. DOI 10.1016/j.str.2012.03.001 · PubMed

Other PDB entries of the same protein (UniProt Q5VW32 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R9M 1.95 Å, Crystal structure of the Brox Bro1 domain
3ZXP 2.5 Å, Structural and Functional Analyses of the Bro1 Domain Protein BROX
3UM2 2.59 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3ULY 2.6 Å, Crystal Structure of BROX Bro1 Domain in Complex with the C-Terminal Tails of CHMP5
3UM1 2.71 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3UM3 3.8 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP4B

Browse structure collections

About this viewer

MolViewer shows 3UM0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.