3ZXP: BRO1 domain-containing protein brox

Structural and Functional Analyses of the Bro1 Domain Protein BROX. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Nov 2011.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 9,299
Mol. weight: 138.22 kDa
Released: 16 Nov 2011

Explore 3ZXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZXP contains 54 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	13	1	1
β-strand	24	1	2
α-helix	26-46	21
α-helix	54-68	15
α-helix	69-71	3
β-strand	90-92	3	1
β-strand	102-104	3	1
α-helix	107-129	23
α-helix	137-156	20
α-helix	157-161	5
α-helix	162-164	3
α-helix	168-170	3
α-helix	177-201	25
α-helix	206-226	21
α-helix	232-262	31
α-helix	267-293	27
β-strand	299	1	3
α-helix	307-326	20
α-helix	327-331	5
α-helix	339-342	4
α-helix	358-362	5
α-helix	367-371	5
β-strand	373	1	2
β-strand	400	1	3

Chain B: 18 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	13	1	4
β-strand	24	1	5
α-helix	27-46	20
α-helix	54-68	15
α-helix	69-71	3
β-strand	90-92	3	4
β-strand	102-104	3	4
α-helix	107-129	23
α-helix	137-160	24
α-helix	162-164	3
α-helix	168-170	3
α-helix	177-201	25
α-helix	206-226	21
α-helix	232-263	32
α-helix	267-293	27
α-helix	307-326	20
α-helix	327-331	5
α-helix	339-340	2
α-helix	353-355	3
α-helix	358-362	5
α-helix	367-371	5
β-strand	373	1	5
β-strand	393	1	4

Chain C: 18 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	13	1	6
β-strand	24	1	7
α-helix	27-46	20
α-helix	54-68	15
α-helix	69-71	3
β-strand	90-92	3	6
β-strand	102-104	3	6
α-helix	107-129	23
α-helix	137-160	24
α-helix	162-164	3
α-helix	168-170	3
α-helix	177-201	25
α-helix	206-226	21
α-helix	232-263	32
α-helix	267-293	27
α-helix	307-326	20
α-helix	327-331	5
α-helix	339-341	3
α-helix	353-355	3
α-helix	358-362	5
α-helix	367-371	5
β-strand	373	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRO1 domain-containing protein brox	A, B, C	protein	407	HOMO SAPIENS	Q5VW32 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3ZXP_1 BRO1 DOMAIN-CONTAINING PROTEIN BROX (chains A, B, C)
GIDPFTMTHWFHRNPLKATAPVSFNYYGVVTGPSASKICNDLRSSRARLLELFTDLSCNP
EMMKNAADSYFSLLQGFINSLDESTQESKLRYIQNFKWTDTLQGQVPSAQQDAVFELISM
GFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKESHLPKLITPAEKGRD
LESRLIEAYVIQCQAEAQEVTIARAIELKHAPGLIAALAYETANFYQKADHTLSSLEPAY
SAKWRKYLHLKMCFYTAYAYCYHGETLLASDKCGEAIRSLQEAEKLYAKAEALCKEYGET
KGPGPTVKPSGHLFFRKLGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPI
PFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIK

Primary citation

Structure of the Bro1 Domain Protein Brox and Functional Analyses of the Alix Bro1 Domain in HIV-1 Budding. Zhai, Q., Landesman, M.B., Robinson, H. et al. PLoS One (2011) 6:27466. DOI 10.1371/JOURNAL.PONE.0027466 · PubMed

Other PDB entries of the same protein (UniProt Q5VW32 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R9M 1.95 Å, Crystal structure of the Brox Bro1 domain
3UM2 2.59 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3ULY 2.6 Å, Crystal Structure of BROX Bro1 Domain in Complex with the C-Terminal Tails of CHMP5
3UM1 2.71 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3UM0 3.1 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP5
3UM3 3.8 Å, Crystal structure of the Brox Bro1 domain in complex with the C-terminal tail of CHMP4B

Browse structure collections

About this viewer

MolViewer shows 3ZXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.