3RIP: Human gamma-tubulin complex protein 4

Crystal Structure of human gamma-tubulin complex protein 4 (GCP4). Determined by X-ray diffraction at 2.3 Å resolution. Released 6 Jul 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,843
Mol. weight: 78.35 kDa
Ligands: MRD
Released: 6 Jul 2011

Explore 3RIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RIP contains 27 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
β-strand	18-20	3	1
β-strand	24-26	3	1
α-helix	36-61	26
α-helix	84-96	13
α-helix	98-113	16
α-helix	119-125	7
α-helix	127-146	20
α-helix	151-162	12
α-helix	166-193	28
β-strand	205-207	3	2
β-strand	257-259	3	2
α-helix	261-263	3
α-helix	270-284	15
α-helix	303-315	13
α-helix	322-347	26
α-helix	350-360	11
α-helix	366-380	15
α-helix	388-402	15
α-helix	411-413	3
β-strand	414-418	5	3
β-strand	452-456	5	3
α-helix	462-464	3
α-helix	468-498	31
α-helix	501-503	3
α-helix	508-530	23
α-helix	531-537	7
α-helix	538-548	11
α-helix	553-570	18
α-helix	571-575	5
α-helix	576-596	21
α-helix	605-634	30
α-helix	639-653	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-tubulin complex component 4	A	protein	677	Homo sapiens	Q9UGJ1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RIP_1 Gamma-tubulin complex component 4 (chains A)
MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIE
QYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSIS
HVNYFLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCH
GVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQD
LRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSIL
KNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDF
YLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEY
HGKEHKDATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFKY
LLSVRRVQAELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLVDNLQYYLQVDVLESQF
SQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQNL
GPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGGT
LGSFGMCGRLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MRD	(4R)-2-methylpentane-2,4-diol	C6 H14 O2	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of gamma-tubulin complex protein GCP4 provides insight into microtubule nucleation. Guillet, V., Knibiehler, M., Gregory-Pauron, L. et al. Nat Struct Mol Biol (2011) 18:915-919. DOI 10.1038/nsmb.2083 · PubMed

Other PDB entries of the same protein (UniProt Q9UGJ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V69 4.2 Å, Structures of GCP4 and GCP5 in the native human gamma-tubulin ring complex
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…
9QVM 6.8 Å, Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the…
7QJ1 7.0 Å, Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly…
8VRD 7.0 Å, Rigid body fitted model for free recombinant gamma tubulin ring complex.
7QJD 7.1 Å, Structure of recombinant human gamma-Tubulin Ring Complex without actin

Browse structure collections

About this viewer

MolViewer shows 3RIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.