6V69: Gamma-tubulin complex component 5

Structures of GCP4 and GCP5 in the native human gamma-tubulin ring complex. Determined by electron microscopy at 4.2 Å resolution. Released 1 Jan 2020.

Method: Electron microscopy
Resolution: 4.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,353
Mol. weight: 194.65 kDa
Released: 1 Jan 2020

Explore 6V69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V69 contains 53 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain I: 28 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
β-strand	17-18	2	1
β-strand	26-27	2	1
α-helix	39-61	23
α-helix	84-113	30
α-helix	119-125	7
α-helix	129-146	18
α-helix	150-152	3
α-helix	153-159	7
α-helix	166-193	28
α-helix	270-284	15
α-helix	302-316	15
α-helix	322-341	20
α-helix	342-347	6
α-helix	350-360	11
α-helix	366-375	10
α-helix	378-381	4
α-helix	383-384	2
α-helix	388-402	15
β-strand	414-418	5	2
α-helix	448-451	4
β-strand	452-456	5	2
α-helix	461-463	3
α-helix	470-498	29
α-helix	499-501	3
α-helix	513-529	17
α-helix	536-547	12
α-helix	554-570	17
α-helix	576-597	22
α-helix	607-629	23
α-helix	640-647	8
α-helix	652-655	4

Chain J: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	268-279	12
α-helix	305-307	3
α-helix	309-335	27
α-helix	361-387	27
α-helix	395-401	7
α-helix	403-415	13
α-helix	416-419	4
α-helix	429-445	17
α-helix	457-481	25
α-helix	553-570	18
α-helix	639-647	9
α-helix	688-690	3
α-helix	692-709	18
α-helix	717-723	7
α-helix	735-743	9
α-helix	757-763	7
α-helix	807-810	4
α-helix	815-837	23
α-helix	882-901	20
α-helix	908-917	10
α-helix	923-940	18
α-helix	947-951	5
α-helix	952-966	15
α-helix	981-998	18
α-helix	1008-1012	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-tubulin complex component 5	J	protein	1024	Homo sapiens	Q96RT8 (AlphaFold model)
Gamma-tubulin complex component 4	I	protein	667	Homo sapiens	Q9UGJ1 (AlphaFold model)

Sequence of entity 1 (J), FASTA

>6V69_1 Gamma-tubulin complex component 5 (chains J)
MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHK
IEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLLCLSDS
PSNSSYVETPRNKEVEKKDDFDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSRE
DSGIQVDRTPLEEQDQNRKLDPCISWKDEPDDRSWLEHHVVHQYWTARPSQFPHSLHLHS
NLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSGVKKLFIFQLIDGKVTVRNNI
IVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVPKKSTEAPFRT
YQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGV
AEVPPDTRNVVRASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWI
VHGHLWDGAREFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQG
PSSRQHTMVSFLKPVLKQIIMAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESV
QSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDF
HEKFAGGDVCVDRSSESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYL
QAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSIS
FENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDV
LLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNY
IMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNL
ALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAG
MEQS

Sequence of entity 2 (I), FASTA

>6V69_2 Gamma-tubulin complex component 4 (chains I)
MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIE
QYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSIS
HVNYFLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCH
GVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQD
LRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSIL
KNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDF
YLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEY
HGKEHKADATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFK
YLLSVRRVQAELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLVDNLQYYLQVDVLESQ
FSQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQN
LGPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGG
TLGSFGM

Primary citation

Asymmetric Molecular Architecture of the Human gamma-Tubulin Ring Complex. Wieczorek, M., Urnavicius, L., Ti, S.C. et al. Cell (2020) 180:165-175.e16. DOI 10.1016/j.cell.2019.12.007 · PubMed

Other PDB entries of the same protein (UniProt Q96RT8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L81 2.2 Å, Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1
8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…
9QVM 6.8 Å, Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the…
7QJ1 7.0 Å, Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly…
8VRD 7.0 Å, Rigid body fitted model for free recombinant gamma tubulin ring complex.
7QJD 7.1 Å, Structure of recombinant human gamma-Tubulin Ring Complex without actin

Browse structure collections

About this viewer

MolViewer shows 6V69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.