3RVC: Non-structural protein 1

Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation. Determined by X-ray diffraction at 1.8 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Influenza A virus
Chains: 1
Atoms: 999
Mol. weight: 16.88 kDa
Released: 24 Aug 2011

Explore 3RVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RVC contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	88-91	4	1
α-helix	95-99	5
β-strand	107-112	6	1
β-strand	115-120	6	1
β-strand	127-137	11	1
β-strand	140-151	12	1
β-strand	156-162	7	1
α-helix	171-187	17
β-strand	191-194	4	1
α-helix	196-201	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A	protein	152	Influenza A virus	P03496 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RVC_1 Non-structural protein 1 (chains A)
MTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIF
DRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETL
QRFAWRSSNENGRPPLTPKQKREMAGTIRSEV

Primary citation

Conservation of a crystallographic interface suggests a role for beta-sheet augmentation in influenza virus NS1 multifunctionality. Kerry, P.S., Long, E., Taylor, M.A. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:858-861. DOI 10.1107/S1744309111019312 · PubMed

Other PDB entries of the same protein (UniProt P03496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZKO 1.7 Å, Structural basis for dsRNA recognition by NS1 protein of human influenza virus A
3O9R 2.0 Å, Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
2GX9 2.1 Å, X-ray structure of influenza virus NS1 effector domain
3O9T 2.2 Å, Effector domain from influenza A/PR/8/34 NS1
3L4Q 2.3 Å, Structural insights into phosphoinositide 3-kinase activation by the influenza A virus…
3O9S 2.48 Å, Effector domain of influenza A/PR/8/34 NS1
3O9Q 2.5 Å, Effector domain of NS1 from A/PR/8/34 containing a W187A mutation
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
3O9U 3.2 Å, Effector domain of influenza A/PR/8/34 NS1
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 3RVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.