3SHV: Microcephalin

Crystal structure of human MCPH1 tandem BRCT domains-gamma H2AX complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Dec 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,230
Mol. weight: 48.22 kDa
Released: 28 Dec 2011

Explore 3SHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SHV contains 27 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	649-653	5	1
α-helix	657-670	14
β-strand	674-676	3	1
β-strand	683-688	6	1
β-strand	694	1	2
α-helix	695-702	8
β-strand	706-709	4	1
α-helix	711-719	9
α-helix	722-724	3
α-helix	726-728	3
β-strand	729	1	1
α-helix	736-746	11
α-helix	760-761	2
β-strand	762-764	3	3
α-helix	765	1
α-helix	772-781	10
β-strand	786-787	2	3
α-helix	790-792	3
β-strand	795-797	3	3
α-helix	803-804	2
β-strand	809-811	3	3
α-helix	813-822	10
α-helix	828-831	4
β-strand	832	1	3

Chain B: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	649-653	5	4
α-helix	657-670	14
β-strand	674-676	3	4
β-strand	683-688	6	4
β-strand	694	1	5
α-helix	695-702	8
β-strand	706-709	4	4
α-helix	711-718	8
α-helix	726-728	3
β-strand	729	1	4
α-helix	736-745	10
α-helix	751	1
α-helix	760-761	2
β-strand	762-764	3	6
α-helix	765	1
α-helix	772-781	10
β-strand	786-787	2	6
β-strand	795-797	3	6
β-strand	809-811	3	6
α-helix	813-822	10
α-helix	825-827	3
α-helix	828-830	3
β-strand	832	1	6

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	138-140	3
β-strand	141	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microcephalin	A, B	protein	206	Homo sapiens	Q8NEM0 (AlphaFold model)
Histone H2A.x	C, D	protein	10	Homo sapiens	P16104 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SHV_1 Microcephalin (chains A, B)
MGHHHHHHMKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSG
KPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAG
PYRGTLFADQPAMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVK
YLSEKWVLDSITQHKVCAPENYLLSQ

Sequence of entity 2 (C, D), FASTA

>3SHV_2 Histone H2A.x (chains C, D)
KKATQASQEY

Primary citation

Specific recognition of phosphorylated tail of H2AX by the tandem BRCT domains of MCPH1 revealed by complex structure. Shao, Z.H., Li, F.D., Sy, S.M.-H. et al. J Struct Biol (2012) 177:459-468. DOI 10.1016/j.jsb.2011.11.022 · PubMed

Other PDB entries of the same protein (UniProt Q8NEM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PA6 1.5 Å, Structure of the N-terminal BRCT domain of human microcephalin (MCPH1)
3U3Z 1.5 Å, Structure of human microcephalin (MCPH1) tandem BRCT domains in complex with an H2A.X…
2WT8 1.6 Å, Structure of the N-terminal BRCT domain of human microcephalin (Mcph1)
3KTF 1.6 Å, Structure of the N-terminal BRCT domain of human microcephalin (MCPH1).
3SHT 1.95 Å, Crystal structure of human MCPH1 tandem BRCT domains
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
3T1N 2.6 Å, Structure of human MICROCEPHALIN (MCPH1) TANDEM BRCT domains in complex with a CDC27…
3SZM 2.63 Å, Structure of human microcephalin (MCPH1) tandem brct domains in complex with a…

Browse structure collections

About this viewer

MolViewer shows 3SHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.