3SIV: NHP2-like protein 1
Structure of a hPrp31-15.5K-U4atac 5' stem loop complex, dimeric form. Determined by X-ray diffraction at 3.3 Å resolution. Released 10 Aug 2011.
- Method
- X-ray diffraction
- Resolution
- 3.3 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 14,114
- Mol. weight
- 211.79 kDa
- Released
- 10 Aug 2011
Explore 3SIV in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3SIV contains 83 α-helices and 20 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 13 | 1 | 1 |
| α-helix | 16-31 | 16 | |
| β-strand | 36-37 | 2 | 1 |
| α-helix | 39-47 | 9 | |
| β-strand | 51-57 | 7 | 1 |
| α-helix | 63-66 | 4 | |
| α-helix | 68-75 | 8 | |
| β-strand | 80-83 | 4 | 1 |
| α-helix | 86-92 | 7 | |
| β-strand | 101-105 | 5 | 1 |
| α-helix | 113-127 | 15 | |
Chain B: 14 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 89-118 | 30 | |
| α-helix | 125-128 | 4 | |
| α-helix | 132-142 | 11 | |
| α-helix | 154-157 | 4 | |
| α-helix | 162-172 | 11 | |
| α-helix | 181-215 | 35 | |
| α-helix | 217-223 | 7 | |
| α-helix | 225-235 | 11 | |
| α-helix | 238-243 | 6 | |
| α-helix | 246-250 | 5 | |
| α-helix | 278-281 | 4 | |
| α-helix | 285-287 | 3 | |
| α-helix | 288-307 | 20 | |
| α-helix | 315-330 | 16 | |
Chain D: 8 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-7 | 3 | |
| β-strand | 13 | 1 | 2 |
| α-helix | 14-15 | 2 | |
| α-helix | 16-31 | 16 | |
| β-strand | 36-37 | 2 | 2 |
| α-helix | 39-47 | 9 | |
| β-strand | 51-56 | 6 | 2 |
| α-helix | 63-66 | 4 | |
| α-helix | 69-75 | 7 | |
| β-strand | 80-82 | 3 | 2 |
| α-helix | 86-93 | 8 | |
| β-strand | 101-105 | 5 | 2 |
| α-helix | 113-124 | 12 | |
Chain E: 15 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 89-118 | 30 | |
| α-helix | 123-127 | 5 | |
| α-helix | 132-141 | 10 | |
| α-helix | 146-149 | 4 | |
| α-helix | 153-156 | 4 | |
| α-helix | 161-170 | 10 | |
| α-helix | 181-215 | 35 | |
| α-helix | 217-222 | 6 | |
| α-helix | 225-235 | 11 | |
| α-helix | 238-242 | 5 | |
| α-helix | 246-251 | 6 | |
| α-helix | 273-276 | 4 | |
| α-helix | 278-281 | 4 | |
| α-helix | 287-306 | 20 | |
| α-helix | 315-331 | 17 | |
Chain G: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 13 | 1 | 3 |
| α-helix | 16-31 | 16 | |
| β-strand | 35-37 | 3 | 3 |
| α-helix | 39-47 | 9 | |
| β-strand | 51-57 | 7 | 3 |
| α-helix | 63-66 | 4 | |
| α-helix | 68-72 | 5 | |
| β-strand | 80-83 | 4 | 3 |
| α-helix | 86-92 | 7 | |
| β-strand | 101-105 | 5 | 3 |
| α-helix | 113-127 | 15 | |
Chain H: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 89-116 | 28 | |
| α-helix | 134-138 | 5 | |
| α-helix | 181-189 | 9 | |
| α-helix | 192-215 | 24 | |
| α-helix | 217-222 | 6 | |
| α-helix | 225-235 | 11 | |
| α-helix | 238-241 | 4 | |
| α-helix | 246-249 | 4 | |
| α-helix | 273-276 | 4 | |
| α-helix | 285-287 | 3 | |
| α-helix | 288-306 | 19 | |
| α-helix | 315-331 | 17 | |
Chain J: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 13 | 1 | 4 |
| α-helix | 14-15 | 2 | |
| α-helix | 16-31 | 16 | |
| β-strand | 35-37 | 3 | 4 |
| α-helix | 39-47 | 9 | |
| β-strand | 51-57 | 7 | 4 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-76 | 8 | |
| β-strand | 80-83 | 4 | 4 |
| α-helix | 86-93 | 8 | |
| β-strand | 101-105 | 5 | 4 |
| α-helix | 113-127 | 15 | |
Chain K: 15 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 89-116 | 28 | |
| α-helix | 125-128 | 4 | |
| α-helix | 132-142 | 11 | |
| α-helix | 153-156 | 4 | |
| α-helix | 161-168 | 8 | |
| α-helix | 181-208 | 28 | |
| α-helix | 212-215 | 4 | |
| α-helix | 217-220 | 4 | |
| α-helix | 225-235 | 11 | |
| α-helix | 239-242 | 4 | |
| α-helix | 246-249 | 4 | |
| α-helix | 273-276 | 4 | |
| α-helix | 278-281 | 4 | |
| α-helix | 287-306 | 20 | |
| α-helix | 315-329 | 15 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| NHP2-like protein 1 | A, D, G, J | protein | 130 | Homo sapiens | P55769 (AlphaFold model) |
| U4/U6 small nuclear ribonucleoprotein Prp31 | B, E, H, K | protein | 254 | Homo sapiens | Q8WWY3 (AlphaFold model) |
| U4atac snRNA | C, F, I, L | RNA | 32 | Homo sapiens | |
Sequence of entity 1 (A, D, G, J), FASTA
>3SIV_1 NHP2-like protein 1 (chains A, D, G, J)
GSMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAA
DAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQS
IQQSIERLLV
Sequence of entity 2 (B, E, H, K), FASTA
>3SIV_2 U4/U6 small nuclear ribonucleoprotein Prp31 (chains B, E, H, K)
GPLGSEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTV
KELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNA
SKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTL
SGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYE
LKDEIERKFDKWQE
Sequence of entity 3 (C, F, I, L), FASTA
>3SIV_3 U4atac snRNA (chains C, F, I, L)
UACUGUCCAAUGAGCGCAUAGUGAGGGCAGUA
Primary citation
Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31. Liu, S., Ghalei, H., Luhrmann, R. et al. RNA (2011) 17:1655-1663. DOI 10.1261/rna.2690611 · PubMed
Other PDB entries of the same protein (UniProt P55769 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2OZB 2.6 Å, Structure of a human Prp31-15.5K-U4 snRNA complex
- 8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
- 3SIU 2.63 Å, Structure of a hPrp31-15.5K-U4atac 5' stem loop complex, monomeric form
- 7MQA 2.7 Å, Cryo-EM structure of the human SSU processome, state post-A1
- 8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
- 1E7K 2.9 Å, Crystal structure of the spliceosomal 15.5kD protein bound to a U4 snRNA fragment
- 6QW6 2.92 Å, Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.
- 8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
- 8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
- 8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
- 8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
- 8H6J 3.25 Å, Cryo-EM structure of human exon-defined spliceosome in the mature pre-B state.
Browse structure collections
About this viewer
MolViewer shows 3SIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.