3SJM: Telomeric repeat-binding factor 2

Crystal Structure Analysis of TRF2-Dbd-DNA complex. Determined by X-ray diffraction at 1.35 Å resolution. Released 31 Oct 2012.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,941
Mol. weight: 26.01 kDa
Released: 31 Oct 2012

Explore 3SJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SJM contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	449-451	3
α-helix	452-465	14
α-helix	470-476	7
α-helix	484-496	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(cptpcptpapgpgpgptptpapgpgpgptptpapg)-3')	C	DNA	18
DNA (5'-d(tpcptpapapcpcpcptpapapcpcpcptpapgpa)-3')	D	DNA	18
Telomeric repeat-binding factor 2	A, B	protein	64	Homo sapiens	Q15554 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>3SJM_1 DNA (5'-D(*CP*TP*CP*TP*AP*GP*GP*GP*TP*TP*AP*GP*GP*GP*TP*TP*AP*G)-3') (chains C)
CTCTAGGGTTAGGGTTAG

Sequence of entity 2 (D), FASTA

>3SJM_2 DNA (5'-D(*TP*CP*TP*AP*AP*CP*CP*CP*TP*AP*AP*CP*CP*CP*TP*AP*GP*A)-3') (chains D)
TCTAACCCTAACCCTAGA

Sequence of entity 3 (A, B), FASTA

>3SJM_3 Telomeric repeat-binding factor 2 (chains A, B)
GSHMTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKR
LGMN

Primary citation

Crystal Structure Analysis of TRF2-Dbd-DNA complex. Nair, S.K., Sliverman, S.K., Chen, J.H. et al. To be published.

Other PDB entries of the same protein (UniProt Q15554 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W0U 1.8 Å, hTRF2 DNA-binding domain in complex with telomeric DNA.
3K6G 1.95 Å, Crystal structure of Rap1 and TRF2 complex
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
6J67 2.05 Å, Crystal structure of the compound 34 in a complex with TRF2
3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
1H6P 2.2 Å, Dimeristion domain from human TRF2
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
4RQI 2.44 Å, Structure of TRF2/RAP1 secondary interaction binding site
3BUA 2.5 Å, Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
9Q9K 2.59 Å, Cryo-EM structure of human Mre11-Rad50 (MR) complex bound to DNA and telomeric factor…
9Q9J 2.71 Å, Cryo-EM structure of human Mre11-Rad50-Nbs1 (MRN) complex bound to DNA and telomeric…

Browse structure collections

About this viewer

MolViewer shows 3SJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.