3U0C: Invasin ipaB

Crystal structure of N-terminal region of Type III Secretion First Translocator IpaB (residues 74-224). Determined by X-ray diffraction at 2.05 Å resolution. Released 15 Feb 2012.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Shigella flexneri
Chains: 2
Atoms: 2,514
Mol. weight: 44.92 kDa
Released: 15 Feb 2012

Explore 3U0C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U0C contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	75-90	16
α-helix	93-95	3
α-helix	96-166	71
α-helix	175-222	48

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	75-90	16
α-helix	93-95	3
α-helix	96-167	72
α-helix	175-222	48

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Invasin ipaB	A, B	protein	201	Shigella flexneri	P18011 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3U0C_1 Invasin ipaB (chains A, B)
GSQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGN
LIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLK
NADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLS
IHSKLTDKSMQLEKEIDSFSA

Primary citation

The Structures of Coiled-Coil Domains from Type III Secretion System Translocators Reveal Homology to Pore-Forming Toxins. Barta, M.L., Dickenson, N.E., Patil, M. et al. J Mol Biol (2012) 417:395-405. DOI 10.1016/j.jmb.2012.01.026 · PubMed

Other PDB entries of the same protein (UniProt P18011 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WKQ 2.1 Å, 2.10 A resolution structure of IpaB (residues 74-242) from Shigella flexneri
3GZ1 2.15 Å, Crystal structure of IpgC in complex with the chaperone binding region of IpaB
6KEA 2.35 Å, crystal structure of MBP-tagged REV7-IpaB complex
3GZ2 2.65 Å, Crystal structure of IpgC in complex with an IpaB peptide

Browse structure collections

About this viewer

MolViewer shows 3U0C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.