5WKQ: Invasin IpaB

2.10 A resolution structure of IpaB (residues 74-242) from Shigella flexneri. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 May 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Shigella flexneri
Chains: 2
Atoms: 2,649
Mol. weight: 39.16 kDa
Released: 16 May 2018

Explore 5WKQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WKQ contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	75-90	16
α-helix	93-95	3
α-helix	96-167	72
α-helix	174-230	57
α-helix	233-237	5

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	75-90	16
α-helix	93-95	3
α-helix	96-166	71
α-helix	173-229	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Invasin IpaB	A, B	protein	174	Shigella flexneri	P18011 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WKQ_1 Invasin IpaB (chains A, B)
GSTGSNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLS
ETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIK
KDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKS

Primary citation

Using disruptive insertional mutagenesis to identify the in situ structure-function landscape of the Shigella translocator protein IpaB. Barta, M.L., Tachiyama, S., Muthuramalingam, M. et al. Protein Sci (2018) 27:1392-1406. DOI 10.1002/pro.3428 · PubMed

Other PDB entries of the same protein (UniProt P18011 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U0C 2.05 Å, Crystal structure of N-terminal region of Type III Secretion First Translocator IpaB…
3GZ1 2.15 Å, Crystal structure of IpgC in complex with the chaperone binding region of IpaB
6KEA 2.35 Å, crystal structure of MBP-tagged REV7-IpaB complex
3GZ2 2.65 Å, Crystal structure of IpgC in complex with an IpaB peptide

Browse structure collections

About this viewer

MolViewer shows 5WKQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.