3U1U: RNA polymerase-associated protein RTF1 homolog

Crystal structure of RNA polymerase-associated protein RTF1 homolog Plus-3 domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Apr 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,302
Mol. weight: 32.31 kDa
Released: 4 Apr 2012

Explore 3U1U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U1U contains 21 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	352	1	1
α-helix	353	1
α-helix	356-360	5
β-strand	363	1	2
α-helix	364-365	2
α-helix	366-372	7
α-helix	378-382	5
β-strand	386-392	7	2
β-strand	399-417	19	2
β-strand	420-430	11	2
β-strand	433-438	6	2
α-helix	439-441	3
β-strand	442	1	2
α-helix	446-448	3
α-helix	449-462	14
α-helix	464-467	4
β-strand	468	1	1
α-helix	469-478	10

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	351	1
β-strand	352	1	3
α-helix	353	1
α-helix	356-359	4
α-helix	360-362	3
β-strand	363	1	4
α-helix	366-372	7
α-helix	378-382	5
β-strand	383	1	5
β-strand	385	1	5
β-strand	386-392	7	4
β-strand	399-417	19	4
β-strand	420-430	11	4
β-strand	433-438	6	4
α-helix	439-441	3
β-strand	442	1	4
α-helix	446-448	3
α-helix	449-461	13
α-helix	465-467	3
β-strand	468	1	3
α-helix	469-478	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase-associated protein RTF1 homolog	A, B	protein	137	Homo sapiens	Q92541 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3U1U_1 RNA polymerase-associated protein RTF1 homolog (chains A, B)
GPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEI
TGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQ
LPTLDEINKKELSIKEA

Primary citation

Crystal structure of RNA polymerase-associated protein RTF1 homolog Plus-3 domain. Guo, Y., Tempel, W., Bian, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q92541 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L1P 2.12 Å, Crystal Structure of Human Rtf1 Plus3 domain
4L1U 2.42 Å, Crystal Structure of Human Rtf1 Plus3 Domain in Complex with Spt5 CTR Phosphopeptide
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27
7UNC 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS complex with rewrapped nucleosome
7UND 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-nucleosome complex (stalled at +38)
6TED 3.1 Å, Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers…
9EH1 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, 20 bp upstream
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8A3Y 3.3 Å, Structure of mammalian Pol II-DSIF-SPT6-PAF1-TFIIS-hexasome elongation complex
9EH0 3.6 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, 30 bp upstream

Browse structure collections

About this viewer

MolViewer shows 3U1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.