6TED: DNA-directed RNA polymerase subunit

Name: PDB 6TED: Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers allosteric elongation activation by RTF1
Published: 2020-07-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers allosteric elongation activation by RTF1. Determined by electron microscopy at 3.1 Å resolution. Released 22 Jul 2020.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Sus scrofa, Homo sapiens, synthetic construct
Chains: 24
Atoms: 57,142
Mol. weight: 1351.87 kDa
Ligands: MG, ZN
Released: 22 Jul 2020

Explore 6TED in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TED contains 315 α-helices and 380 β-strands across 21 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 76 helices, 75 β-strands

Element	Residues	Length	Sheet
β-strand	15-16	2	1
β-strand	20-22	3	2
α-helix	25-27	3
α-helix	28-34	7
β-strand	43	1	3
β-strand	47-49	3	4
β-strand	51-52	2	4
β-strand	56	1	3
β-strand	86-88	3	5
β-strand	94	1	6
α-helix	100-109	10
α-helix	111	1
α-helix	124-132	9
α-helix	137-147	11
β-strand	192-194	3	7
β-strand	197-199	3	7
β-strand	215	1	7
α-helix	218-226	9
α-helix	232-235	4
α-helix	245-248	4
β-strand	250	1	6
β-strand	253-255	3	5
α-helix	256	1
β-strand	264	1	8
β-strand	272	1	8
α-helix	273-274	2
α-helix	275-292	18
α-helix	293-297	5
α-helix	302-318	17
β-strand	329-330	2	9
β-strand	334-335	2	9
α-helix	339-342	4
α-helix	349	1
α-helix	350-354	5
β-strand	357-358	2	10
β-strand	363-369	7	11
β-strand	377-380	4	11
α-helix	382-385	4
β-strand	389-393	5	12
α-helix	401-408	8
β-strand	416	1	12
β-strand	420	1	12
β-strand	426	1	12
α-helix	429-431	3
β-strand	445-449	5	12
α-helix	450	1
β-strand	455-460	6	11
α-helix	466-468	3
β-strand	471-476	6	11
β-strand	482-484	3	11
α-helix	489-492	4
β-strand	500-504	5	11
α-helix	509-518	10
β-strand	520	1	11
α-helix	521-523	3
β-strand	526	1	13
β-strand	533	1	13
α-helix	540-548	9
β-strand	554-555	2	14
α-helix	557-563	7
α-helix	564-566	3
α-helix	574	1
β-strand	575	1	15
α-helix	576-577	2
β-strand	579-581	3	16
β-strand	585	1	16
β-strand	586-587	2	14
α-helix	588-595	8
β-strand	601-604	4	17
β-strand	628-631	4	17
β-strand	635-637	3	17
α-helix	642-645	4
α-helix	652-659	8
α-helix	663-683	21
β-strand	686	1	18
α-helix	690-692	3
α-helix	698-721	24
α-helix	726-728	3
β-strand	729	1	19
β-strand	731	1	19
α-helix	733-757	25
α-helix	766-771	6
α-helix	778-781	4
α-helix	782-786	5
β-strand	789-790	2	20
β-strand	793	1	21
β-strand	796	1	21
α-helix	818-820	3
β-strand	822-823	2	20
α-helix	833-868	36
β-strand	872-873	2	22
β-strand	879-880	2	22
β-strand	886-888	3	22
α-helix	891-893	3
β-strand	896	1	23
β-strand	902-905	4	24
α-helix	917-920	4
α-helix	927-933	7
β-strand	934	1	25
α-helix	941-944	4
α-helix	946-969	24
α-helix	971-973	3
β-strand	976-979	4	24
α-helix	983-993	11
α-helix	1001	1
β-strand	1002	1	25
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1053-1056	4
α-helix	1062-1076	15
β-strand	1080	1	23
α-helix	1081-1082	2
α-helix	1087-1096	10
α-helix	1098-1101	4
α-helix	1121-1128	8
β-strand	1140	1	26
β-strand	1142	1	27
β-strand	1143	1	28
α-helix	1151-1161	11
β-strand	1164	1	29
α-helix	1166-1169	4
β-strand	1170-1176	7	30
α-helix	1191-1194	4
β-strand	1211-1216	6	30
α-helix	1228-1237	10
α-helix	1240-1242	3
β-strand	1243	1	31
β-strand	1256-1257	2	30
β-strand	1260	1	30
β-strand	1261	1	31
α-helix	1283-1294	12
β-strand	1299	1	29
β-strand	1308-1310	3	27
β-strand	1319-1320	2	32
β-strand	1330-1331	2	32
β-strand	1335-1337	3	27
α-helix	1344-1347	4
β-strand	1352	1	28
β-strand	1358	1	26
α-helix	1364-1368	5
α-helix	1372-1387	16
α-helix	1396-1405	10
α-helix	1416-1419	4
α-helix	1426-1429	4
α-helix	1437-1445	9
β-strand	1448-1449	2	2
α-helix	1456-1459	4
β-strand	1472-1475	4	33
α-helix	1479-1481	3
α-helix	1534-1537	4

Chain B: 49 helices, 77 β-strands

Element	Residues	Length	Sheet
α-helix	23-36	14
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-58	4
α-helix	63-65	3
β-strand	83-84	2	34
β-strand	87-93	7	35
β-strand	97	1	36
β-strand	107	1	36
α-helix	108-109	2
α-helix	110-115	6
β-strand	121-129	9	35
β-strand	132-133	2	34
β-strand	140	1	34
β-strand	143-153	11	35
β-strand	155	1	37
α-helix	168-173	6
β-strand	185-186	2	37
β-strand	191-194	4	37
β-strand	196-200	5	38
α-helix	201	1
β-strand	206-208	3	39
β-strand	215-223	9	39
β-strand	233-240	8	39
β-strand	256	1	39
β-strand	257-258	2	40
β-strand	267-268	2	40
α-helix	269-275	7
α-helix	282-288	7
α-helix	295-305	11
α-helix	314-322	9
α-helix	332-339	8
α-helix	342-346	5
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	38
α-helix	398-423	26
α-helix	440-450	11
α-helix	456-461	6
β-strand	467-469	3	37
α-helix	475-482	8
β-strand	484-486	3	38
α-helix	497-499	3
β-strand	509	1	41
β-strand	523-525	3	38
β-strand	526	1	41
β-strand	531-532	2	42
α-helix	539-547	9
β-strand	551	1	43
α-helix	553-555	3
α-helix	558-560	3
β-strand	565-569	5	43
β-strand	572-577	6	43
α-helix	580-592	13
β-strand	602-606	5	43
β-strand	611-615	5	43
β-strand	621-627	7	42
β-strand	628	1	44
β-strand	633	1	44
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	42
α-helix	670-672	3
β-strand	675-676	2	42
α-helix	679-682	4
β-strand	695-696	2	42
α-helix	700-703	4
α-helix	708-710	3
α-helix	714-716	3
β-strand	717	1	45
α-helix	719-728	10
β-strand	732	1	46
β-strand	748-751	4	47
β-strand	755	1	48
β-strand	759-760	2	49
β-strand	776-782	7	50
β-strand	783	1	18
β-strand	793-797	5	50
α-helix	798-802	5
β-strand	808-817	10	47
β-strand	827-829	3	51
β-strand	837	1	51
α-helix	845-847	3
β-strand	849	1	52
β-strand	853	1	52
β-strand	859	1	47
β-strand	865-867	3	52
β-strand	869-872	4	51
β-strand	889-891	3	51
β-strand	894-895	2	52
α-helix	896-897	2
β-strand	903-911	9	47
β-strand	917-927	11	47
β-strand	934-937	4	50
β-strand	944-949	6	50
β-strand	956	1	53
β-strand	965-966	2	50
α-helix	969-971	3
β-strand	977	1	45
α-helix	978-993	16
β-strand	997-998	2	49
α-helix	1008-1015	8
β-strand	1025-1026	2	50
β-strand	1029	1	53
α-helix	1035	1
β-strand	1036	1	53
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	50
β-strand	1051	1	46
α-helix	1055-1057	3
β-strand	1060-1061	2	11
β-strand	1067	1	54
β-strand	1074	1	54
β-strand	1085-1086	2	10
α-helix	1089-1095	7
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1116-1119	4	1
β-strand	1125	1	1
β-strand	1127	1	55
β-strand	1136	1	55
β-strand	1146-1149	4	1
α-helix	1153-1163	11
β-strand	1170-1172	3	2

Chain C: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	56
β-strand	18-24	7	56
α-helix	28-39	12
β-strand	44-55	12	57
α-helix	62-69	8
β-strand	73	1	58
α-helix	85-87	3
β-strand	99-106	8	57
β-strand	113-115	3	59
β-strand	121-122	2	57
β-strand	129	1	58
β-strand	151-153	3	59
β-strand	158-168	11	57
α-helix	174-176	3
β-strand	179-182	4	56
β-strand	185-186	2	56
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	56
α-helix	241-268	28

Chain D: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	24-27	4
β-strand	30-31	2	33
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	78-88	11
α-helix	96-102	7
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14

Chain E: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	4-23	20
β-strand	26	1	60
α-helix	30-33	4
α-helix	37-43	7
β-strand	60-63	4	61
β-strand	64	1	60
β-strand	71-74	4	61
β-strand	75	1	62
α-helix	84-92	9
β-strand	101	1	61
β-strand	104-106	3	62
α-helix	109-111	3
α-helix	112-120	9
β-strand	129-131	3	62
α-helix	134-136	3
α-helix	139-141	3
β-strand	147-150	4	63
α-helix	151-152	2
α-helix	153-162	10
α-helix	167-169	3
β-strand	172-173	2	63
α-helix	178-183	6
β-strand	190-195	6	63
β-strand	203-209	7	63

Chain F: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	64
α-helix	59-74	16
α-helix	89-98	10
β-strand	104-109	6	33
β-strand	115-119	5	33
β-strand	124	1	64
α-helix	125	1

Chain G: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	33
α-helix	15-17	3
α-helix	22-31	10
β-strand	44-54	11	33
β-strand	58-59	2	33
α-helix	60	1
β-strand	66-77	12	33
β-strand	84-85	2	65
β-strand	88-93	6	66
β-strand	96-101	6	66
β-strand	104-108	5	66
β-strand	142	1	66
β-strand	145-146	2	65
β-strand	149	1	67
β-strand	152	1	68
β-strand	157	1	68
β-strand	160	1	67

Chain H: 1 helix, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	69
β-strand	8-15	8	69
β-strand	25-32	8	69
β-strand	38	1	69
β-strand	40-44	5	69
β-strand	55-58	4	69
β-strand	61	1	69
β-strand	65	1	70
β-strand	74	1	15
β-strand	83	1	70
α-helix	85-87	3
β-strand	90	1	69
β-strand	91-92	2	16
β-strand	93-101	9	69
β-strand	112-117	6	69
β-strand	122-125	4	69
β-strand	140-142	3	69
β-strand	145-148	4	69

13 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1984	Sus scrofa	A0A7M4DUC2
DNA-directed RNA polymerase subunit beta	B	protein	1251	Sus scrofa	I3LGP4 (AlphaFold model)
RNA polymerase II subunit C	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RNA polymerase II subunit D	D	protein	142	Sus scrofa	A0A287ADR4 (AlphaFold model)
RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
RNA polymerase II subunit F	F	protein	127	Sus scrofa	A0A4X1VEK9
RNA polymerase II subunit G	G	protein	172	Sus scrofa	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
Uncharacterized protein	J	protein	67	Sus scrofa	A0A8W4F9W9
Uncharacterized protein	K	protein	117	Sus scrofa	F1RKE4
Uncharacterized protein	L	protein	58	Sus scrofa	A0A4X1TRS6

12 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>6TED_1 DNA-directed RNA polymerase subunit (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPT
SPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSY
SPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTS
PKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDS
DEEN

Sequence of entity 2 (B), FASTA

>6TED_2 DNA-directed RNA polymerase subunit beta (chains B)
MCSTNLSQALAYFRAGANLTAASLWAGFRGSRRIFWERRKRKSLCLALRPGGACWRWLLA
VSCVSLRGLGAPGSCANMYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQ
LDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDG
APSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLL
NGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRS
CLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRD
ILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVL
QKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFL
FRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQAR
AGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLV
KNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQL
MNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQL
KEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMI
LGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRS
MEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGF
DQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGT
NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKG
TCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFN
DAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRA
RGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCG
IMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>6TED_3 RNA polymerase II subunit C (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>6TED_4 RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>6TED_5 RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>6TED_6 RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>6TED_7 RNA polymerase II subunit G (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>6TED_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>6TED_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>6TED_10 Uncharacterized protein (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>6TED_11 Uncharacterized protein (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>6TED_12 Uncharacterized protein (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	9

Primary citation

Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation. Vos, S.M., Farnung, L., Linden, A. et al. Nat Struct Mol Biol (2020) 27:668-677. DOI 10.1038/s41594-020-0437-1 · PubMed

Other PDB entries of the same protein (UniProt A0A7M4DUC2), best resolution first:

9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27
7UNC 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS complex with rewrapped nucleosome
7UND 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-nucleosome complex (stalled at +38)
8A40 3.0 Å, Structure of mammalian Pol II-TFIIS elongation complex
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8A3Y 3.3 Å, Structure of mammalian Pol II-DSIF-SPT6-PAF1-TFIIS-hexasome elongation complex
9ER2 3.3 Å, PolII-TCR-STK19 structure.
8S54 3.4 Å, RNA polymerase II early elongation complex bound to TFIIE and TFIIF - state b (composite…

Browse structure collections

About this viewer

MolViewer shows 6TED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.