3UF8: PDB entry 3UF8

Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with a G95A surface mutation from Burkholderia pseudomallei complexed with FK506. Determined by X-ray diffraction at 1.5 Å resolution. Released 9 Nov 2011.

Method: X-ray diffraction
Resolution: 1.5 Å
Organisms: Saccharomyces cerevisiae, Burkholderia pseudomallei
Chains: 1
Atoms: 1,823
Mol. weight: 23.82 kDa
Ligands: FK5
Released: 9 Nov 2011

Explore 3UF8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UF8 contains 9 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	-75--69	7	1
β-strand	-64--58	7	1
α-helix	-52--42	11
α-helix	-38--36	3
β-strand	-34--31	4	1
β-strand	-28--27	2	1
α-helix	-26	1
β-strand	-11--6	6	1
α-helix	-3	1
β-strand	4-5	2	2
β-strand	11-16	6	2
α-helix	21	1
β-strand	22	1	3
α-helix	23	1
β-strand	28-37	10	2
β-strand	42-45	4	2
α-helix	47-49	3
β-strand	53-56	4	2
α-helix	64-70	7
β-strand	74	1	3
β-strand	78-83	6	2
α-helix	85-87	3
β-strand	94	1	4
β-strand	98	1	4
β-strand	104-112	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein SMT3, Peptidyl-prolyl cis-trans isomerase	A	protein	209	Saccharomyces cerevisiae, Burkholderia pseudomallei	Q12306 (AlphaFold model), Q3JK38 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UF8_1 Ubiquitin-like protein SMT3, Peptidyl-prolyl cis-trans isomerase (chains A)
MGHHHHHHSGEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDS
LRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEAR
AGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIP
PQLGYGARGAAGVIPPNATLVFEVELLDV

Ligands and cofactors

ID	Name	Formula	Copies
FK5	8-deethyl-8-[but-3-enyl]-ascomycin	C44 H69 N O12	1

Primary citation

A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins. Begley, D.W., Fox, D., Jenner, D. et al. Antimicrob Agents Chemother (2014) 58:1458-1467. DOI 10.1128/AAC.01875-13 · PubMed

Other PDB entries of the same protein (UniProt Q12306 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UKZ 1.52 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 6
3UQA 1.55 Å, Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface…
3VAW 1.55 Å, Crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase with surface…
5YCA 1.57 Å, Crystal structure of inner membrane protein Bqt4 in complex with LEM2
7P7W 1.57 Å, N-acetylglucosamine kinase from Plesiomonas shigelloides compexed with…
1EUV 1.6 Å, X-ray structure of the C-terminal ULP1 protease domain in complex with SMT3, the yeast…
6UKU 1.68 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 3
7P7I 1.7 Å, Native structure of N-acetylglucosamine kinase from Plesiomonas shigelloides
6UKM 1.74 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound MSA-2
4G50 1.75 Å, Crystal structure of a SMT fusion Peptidyl-prolyl cis-trans isomerase with surface…
7P9L 1.75 Å, N-acetylglucosamine kinase from Plesiomonas shigelloides compexed with…
6UL0 1.76 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 4

Browse structure collections

About this viewer

MolViewer shows 3UF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.