Crystal structure of a SMT Fusion PEPTIDYL-PROLYL CIS-TRANS ISOMERASE with surface mutation D44G from Burkholderia pseudomallei complexed with FK506. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Nov 2011.
Explore 3UQB in 3D Show helices and sheets RCSB PDB PDBe
3UQB contains 7 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -75--69 | 7 | 1 |
| β-strand | -64--58 | 7 | 1 |
| α-helix | -52--42 | 11 | |
| α-helix | -38--36 | 3 | |
| β-strand | -34--31 | 4 | 1 |
| β-strand | -28--27 | 2 | 1 |
| β-strand | -10--6 | 5 | 1 |
| α-helix | -3 | 1 | |
| β-strand | 3-5 | 3 | 2 |
| β-strand | 11-16 | 6 | 2 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 3 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 2 |
| β-strand | 42-45 | 4 | 2 |
| β-strand | 53-56 | 4 | 2 |
| α-helix | 64-70 | 7 | |
| β-strand | 74 | 1 | 3 |
| β-strand | 78-83 | 6 | 2 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 4 |
| β-strand | 98 | 1 | 4 |
| β-strand | 104-112 | 9 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like protein SMT3, Peptidyl-prolyl cis-trans isomerase | A | protein | 209 | Saccharomyces cerevisiae, Burkholderia pseudomallei | Q12306 (AlphaFold model), Q3JK38 (AlphaFold model) |
>3UQB_1 Ubiquitin-like protein SMT3, Peptidyl-prolyl cis-trans isomerase (chains A) MGHHHHHHSGEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDS LRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEAR AGQTVSVHYTGWLTDGQKFGSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIP PQLGYGARGAGGVIPPNATLVFEVELLDV
| ID | Name | Formula | Copies |
|---|---|---|---|
| FK5 | 8-deethyl-8-[but-3-enyl]-ascomycin | C44 H69 N O12 | 1 |
A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins. Begley, D.W., Fox, D., Jenner, D. et al. Antimicrob Agents Chemother (2014) 58:1458-1467. DOI 10.1128/AAC.01875-13 · PubMed
Other PDB entries of the same protein (UniProt Q12306 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3UQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.