3US1: P63 DNA Binding Domain

Structure of p63 DNA Binding Domain in Complex with a 22 Base Pair Response Element Containing a Two Base Pair "GC" Spacer Between Half Sites. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,538
Mol. weight: 52.25 kDa
Ligands: ZN
Released: 1 Feb 2012

Explore 3US1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3US1 contains 6 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	132	1	1
β-strand	139-141	3	2
β-strand	153-156	4	1
β-strand	161-165	5	1
β-strand	169-175	7	2
β-strand	185-192	8	1
β-strand	203	1	3
β-strand	224	1	3
β-strand	226-228	3	2
β-strand	235-238	4	1
β-strand	245-250	6	1
α-helix	253-255	3
β-strand	261-267	7	2
β-strand	282-289	8	1
β-strand	295-306	12	1
α-helix	309-318	10

Chain D: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	132	1	4
β-strand	139-141	3	5
β-strand	153-156	4	4
α-helix	157-159	3
β-strand	161-165	5	4
β-strand	169-175	7	5
β-strand	185-192	8	4
β-strand	203	1	6
α-helix	206-209	4
α-helix	212-215	4
β-strand	224	1	6
β-strand	226-228	3	5
β-strand	235-238	4	4
β-strand	245-250	6	4
β-strand	261-267	7	5
β-strand	282-289	8	4
β-strand	295-306	12	4
α-helix	309-318	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein 63	A, D	protein	203	Homo sapiens	Q9H3D4 (AlphaFold model)
5'-d(apapapcpaptpgptptptpgpcpapapapcpaptpgptptpt)-3'	F	DNA	22

Sequence of entity 1 (A, D), FASTA

>3US1_1 Tumor protein 63 (chains A, D)
GSHMASPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPP
PQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDP
ITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC
FEARICACPGRDRKADEDSIRKQ

Sequence of entity 2 (F), FASTA

>3US1_2 5'-D(*AP*AP*AP*CP*AP*TP*GP*TP*TP*TP*GP*CP*AP*AP*AP*CP*AP*TP*GP*TP*TP*T)-3' (chains F)
AAACATGTTTGCAAACATGTTT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63. Chen, C., Gorlatova, N., Herzberg, O. J Biol Chem (2012) 287:7477-7486. DOI 10.1074/jbc.M111.315820 · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…

Browse structure collections

About this viewer

MolViewer shows 3US1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.