Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164. Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Feb 2012.
Explore 3V60 in 3D Show helices and sheets RCSB PDB PDBe
3V60 contains 10 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-29 | 7 | 1 |
| β-strand | 34-40 | 7 | 1 |
| α-helix | 46-56 | 11 | |
| β-strand | 64-67 | 4 | 1 |
| β-strand | 70-72 | 3 | 1 |
| β-strand | 88-92 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 2 |
| α-helix | 10-19 | 10 | |
| β-strand | 25-31 | 7 | 3 |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 46-53 | 8 | 3 |
| α-helix | 54-56 | 3 | |
| β-strand | 57-62 | 6 | 2 |
| β-strand | 66-71 | 6 | 3 |
| α-helix | 72-79 | 8 | |
| β-strand | 87-92 | 6 | 2 |
| β-strand | 98-104 | 7 | 2 |
| β-strand | 111-117 | 7 | 2 |
| α-helix | 118 | 1 | |
| β-strand | 135-140 | 6 | 3 |
| α-helix | 141-152 | 12 | |
| β-strand | 157-163 | 7 | 4 |
| β-strand | 166-172 | 7 | 4 |
| β-strand | 177-182 | 6 | 4 |
| β-strand | 185 | 1 | 5 |
| α-helix | 191-193 | 3 | |
| β-strand | 195 | 1 | 5 |
| β-strand | 196-199 | 4 | 3 |
| β-strand | 203-208 | 6 | 4 |
| α-helix | 209-215 | 7 | |
| α-helix | 216-220 | 5 | |
| β-strand | 224-229 | 6 | 3 |
| β-strand | 235-241 | 7 | 3 |
| β-strand | 244-250 | 7 | 3 |
| α-helix | 251-254 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like protein SMT3 | A | protein | 84 | Saccharomyces cerevisiae | Q12306 (AlphaFold model) |
| Proliferating cell nuclear antigen | B | protein | 258 | Saccharomyces cerevisiae | P15873 (AlphaFold model) |
>3V60_1 Ubiquitin-like protein SMT3 (chains A) GSHMRPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQA DQTPEDLDMEDNDIIEAHREQIGG
>3V60_2 Proliferating cell nuclear antigen (chains B) MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEY RCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMD IDADFLGIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSV IIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFD LKSGFLQFFLAPKFNDEE
Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2. Armstrong, A.A., Mohideen, F., Lima, C.D. Nature (2012) 483:59-63. DOI 10.1038/nature10883 · PubMed
Other PDB entries of the same protein (UniProt Q12306 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3V60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.