3V69: Filia-N crystal structure

Filia-N crystal structure. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Feb 2012.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,031
Mol. weight: 33.35 kDa
Released: 15 Feb 2012

Explore 3V69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3V69 contains 16 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	1
β-strand	20-23	4	1
α-helix	27-30	4
α-helix	35-38	4
β-strand	42-46	5	2
α-helix	48-50	3
α-helix	51-55	5
α-helix	57-59	3
α-helix	62-69	8
β-strand	72-76	5	2
β-strand	84-89	6	2
α-helix	92-116	25

Chain B: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	13-17	5	3
β-strand	20-23	4	3
α-helix	27-30	4
α-helix	35-39	5
β-strand	41-46	6	4
α-helix	48-50	3
α-helix	51-55	5
α-helix	57-59	3
α-helix	62-69	8
β-strand	72-76	5	4
α-helix	83	1
β-strand	84-89	6	4
α-helix	98-112	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Filia	A, B	protein	140	Mus musculus	Q9CWU5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3V69_1 Protein Filia (chains A, B)
MHHHHHHENLYFQSNAMASLKRFQTLVPLDHKQGTLFEIIGEPKLPKWFHVECLEDPKRL
YVEPRLLEIMFGKDGEHIPHLESMLHTLIHVNVWGPERRAEIWIFGPPPFRRDVDRMLTD
LAHYCRMKLMEIEALEAGVE

Primary citation

The N-terminus of FILIA Forms an Atypical KH Domain with a Unique Extension Involved in Interaction with RNA. Wang, J., Xu, M., Zhu, K. et al. PLoS One (2012) 7:e30209-e30209. DOI 10.1371/journal.pone.0030209 · PubMed

Other PDB entries of the same protein (UniProt Q9CWU5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

24MC 3.4 Å, Structure of oocyte cytoplasmic lattices
12DL 3.5 Å, Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs
9XRL 3.74 Å, Structure of mouse cytoplasmic lattice (CPL) repeating unit
9SFP 4.2 Å, Native cytoplasmic lattices from mouse oocytes
9W2M 4.2 Å, Cryo-EM structure of the Cytoplasmic lattice(CPL) from mouse oocyte
9T63 4.7 Å, Asymmetric unit of a cytoplasmic lattice filament repeat unit
9T66 5.3 Å, Complex linking two repeat units of a cytoplasmic lattice filament
9T64 7.3 Å, Cytoplasmic lattice filament repeat unit with the central FBXW-SKP1 complex
9T67 7.7 Å, Cytoplasmic lattice filament repeat unit with ubiquitin
9T68 8.0 Å, Composite structure of the repeat unit of cytoplasmic lattice filament

Browse structure collections

About this viewer

MolViewer shows 3V69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.