3V8O: Human Filamin C Ig - like Domains 4 and 5

Human Filamin C Ig - like Domains 4 and 5. Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Jul 2013.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,902
Mol. weight: 41.25 kDa
Released: 17 Jul 2013

Explore 3V8O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3V8O contains 16 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	574-577	4	1
α-helix	579-581	3
β-strand	583-585	3	2
α-helix	589	1
β-strand	590-596	7	1
α-helix	601-603	3
β-strand	604-609	6	2
β-strand	617-620	4	1
β-strand	625-630	6	1
β-strand	636-644	9	2
β-strand	647-648	2	2
α-helix	652	1
β-strand	654-659	6	2
α-helix	660-662	3
β-strand	665	1	3
α-helix	667-669	3
β-strand	671-673	3	4
α-helix	675-677	3
β-strand	682-683	2	5
β-strand	688-693	6	4
β-strand	698	1	3
β-strand	702-708	7	6
β-strand	713	1	6
β-strand	717-720	4	4
β-strand	725-730	6	4
β-strand	737-744	8	6
β-strand	747-748	2	6
α-helix	749	1
β-strand	754-757	4	6
β-strand	758-759	2	5

Chain B: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	574-577	4	7
α-helix	579-581	3
β-strand	583-585	3	8
β-strand	590-596	7	7
α-helix	601-603	3
β-strand	604-609	6	8
β-strand	616-620	5	7
β-strand	625-630	6	7
β-strand	636-644	9	8
β-strand	647-648	2	8
α-helix	649	1
α-helix	652	1
β-strand	654-659	6	8
β-strand	665	1	9
α-helix	667-669	3
β-strand	671-673	3	10
α-helix	675-677	3
β-strand	682	1	11
α-helix	683	1
β-strand	688-693	6	10
β-strand	698	1	9
β-strand	701	1	12
β-strand	703-708	6	13
β-strand	713	1	13
β-strand	717-720	4	10
β-strand	725-730	6	10
β-strand	737-743	7	13
β-strand	745	1	12
β-strand	748	1	13
α-helix	749	1
β-strand	754-757	4	13
β-strand	758	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-C	A, B	protein	194	Homo sapiens	Q14315 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3V8O_1 Filamin-C (chains A, B)
QAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCD
VRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKP
AEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGV
NVPKSPFRVNVGEG

Primary citation

A novel structural unit in the N-terminal region of filamins. Sethi, R., Seppala, J., Tossavainen, H. et al. J Biol Chem (2014) 289:8588-8598. DOI 10.1074/jbc.M113.537456 · PubMed

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 3V8O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.