7OUV: Isoform 2 of Filamin-C

Crystal structure of human filamin C domains 14-15 cardiovascular disease causing mutation S1624L. Determined by X-ray diffraction at 1.8 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,376
Mol. weight: 43.01 kDa
Released: 22 Jun 2022

Explore 7OUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OUV contains 17 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	8-10	3
β-strand	12-14	3	2
α-helix	16-18	3
β-strand	23-24	2	3
β-strand	29-34	6	2
β-strand	39	1	1
β-strand	43-48	6	3
β-strand	54-55	2	3
β-strand	58-61	4	2
β-strand	66-71	6	2
β-strand	77-85	9	3
β-strand	88-89	2	3
α-helix	90	1
α-helix	93-94	2
β-strand	95-100	6	3
α-helix	101	1
α-helix	105-107	3
β-strand	109-114	6	4
β-strand	117-119	3	4
β-strand	120	1	5
β-strand	121	1	4
β-strand	126-128	3	6
β-strand	129	1	7
β-strand	133-138	6	4
β-strand	147-152	6	6
β-strand	158-161	4	6
α-helix	162	1
β-strand	163-165	3	4
β-strand	170-175	6	4
β-strand	177	1	7
β-strand	181-189	9	6
β-strand	192-193	2	6
α-helix	194	1
α-helix	197	1
β-strand	199-204	6	6

Chain B: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	8
α-helix	8-10	3
β-strand	12-14	3	9
α-helix	16-18	3
β-strand	23-24	2	10
β-strand	29-34	6	9
β-strand	39	1	8
β-strand	43-48	6	10
β-strand	54-55	2	10
β-strand	58-61	4	9
β-strand	66-71	6	9
β-strand	77-85	9	10
β-strand	88-89	2	10
α-helix	90	1
α-helix	93-94	2
β-strand	95-100	6	10
α-helix	101	1
α-helix	105-107	3
β-strand	109-114	6	11
β-strand	117-118	2	11
β-strand	120	1	5
β-strand	126-128	3	12
β-strand	132-138	7	11
β-strand	147-152	6	12
β-strand	158-161	4	12
β-strand	163-165	3	11
β-strand	170-176	7	11
β-strand	181-189	9	12
β-strand	192-193	2	12
α-helix	194	1
α-helix	197	1
β-strand	199-204	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Filamin-C	A, B	protein	205	Homo sapiens	Q14315 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7OUV_1 Isoform 2 of Filamin-C (chains A, B)
GPLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR
DNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYLPFRIHALPTGDASKCLVTVSIGGHGLG
ACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEP
GKYVITIRFGGEHIPNSPFHVLATE

Primary citation

Analysis and prediction of pathogenic missense variants in human filamin C. Mlynek, G., Djinovic-Carugo, K. To be published.

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 7OUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.