7OUU: Human filamin C domains 14-15

Crystal structure of human filamin C domains 14-15. Determined by X-ray diffraction at 1.47 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 1.47 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,379
Mol. weight: 42.96 kDa
Released: 22 Jun 2022

Explore 7OUU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OUU contains 14 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	1537	1	1
α-helix	1539-1541	3
β-strand	1543-1545	3	2
α-helix	1547-1549	3
β-strand	1554-1555	2	3
β-strand	1560-1565	6	2
β-strand	1570	1	1
β-strand	1574-1579	6	3
β-strand	1585-1586	2	3
β-strand	1589-1592	4	2
β-strand	1597-1602	6	2
β-strand	1608-1616	9	3
β-strand	1619-1620	2	3
α-helix	1621	1
α-helix	1624	1
β-strand	1626-1631	6	3
α-helix	1636-1638	3
β-strand	1640-1645	6	4
β-strand	1648-1649	2	4
β-strand	1657-1659	3	5
β-strand	1664-1669	6	4
β-strand	1678-1683	6	5
β-strand	1689-1692	4	5
β-strand	1694-1696	3	4
β-strand	1701-1706	6	4
β-strand	1712-1720	9	5
β-strand	1723-1724	2	5
α-helix	1725	1
α-helix	1728	1
β-strand	1730-1735	6	5

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	1537	1	6
α-helix	1539-1541	3
β-strand	1543-1545	3	7
α-helix	1547-1549	3
β-strand	1554-1555	2	8
β-strand	1560-1565	6	7
β-strand	1570	1	6
β-strand	1574-1579	6	8
β-strand	1585-1586	2	8
β-strand	1589-1592	4	7
β-strand	1597-1602	6	7
β-strand	1608-1616	9	8
β-strand	1619-1620	2	8
α-helix	1621	1
α-helix	1624	1
β-strand	1626-1631	6	8
α-helix	1632	1
α-helix	1636-1638	3
β-strand	1640-1645	6	9
β-strand	1648-1651	4	9
β-strand	1657-1659	3	10
β-strand	1663-1669	7	9
β-strand	1678-1683	6	10
β-strand	1689-1692	4	10
β-strand	1694-1696	3	9
β-strand	1701-1707	7	9
β-strand	1712-1720	9	10
β-strand	1723-1724	2	10
α-helix	1725	1
β-strand	1730-1735	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Filamin-C	A, B	protein	205	Homo sapiens	Q14315 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7OUU_1 Isoform 2 of Filamin-C (chains A, B)
GPLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR
DNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLG
ACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEP
GKYVITIRFGGEHIPNSPFHVLATE

Primary citation

Analysis and prediction of pathogenic missense variants in human filamin C. Mlynek, G., Djinovic-Carugo, K. To be published.

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 7OUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.