4MGX: Filamin-C

Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex. Determined by X-ray diffraction at 3.16 Å resolution. Released 5 Feb 2014.

Method: X-ray diffraction
Resolution: 3.16 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,441
Mol. weight: 20.86 kDa
Released: 5 Feb 2014

Explore 4MGX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MGX contains 8 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	575-577	3	1
α-helix	579-581	3
β-strand	583-585	3	2
β-strand	590-595	6	1
β-strand	605-610	6	2
β-strand	616-620	5	1
β-strand	625-630	6	1
β-strand	636-645	10	2
β-strand	647-648	2	2
α-helix	652	1
β-strand	654-659	6	2
α-helix	660	1
β-strand	665	1	3
α-helix	667-669	3
β-strand	671-673	3	4
α-helix	675-677	3
β-strand	688-693	6	4
α-helix	695-697	3
β-strand	698	1	3
β-strand	702-708	7	5
β-strand	713	1	5
β-strand	717-720	4	4
β-strand	725-730	6	4
β-strand	738-744	7	5
β-strand	747-748	2	5
α-helix	749	1
α-helix	752	1
β-strand	754-755	2	5

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	579-584	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-C	A	protein	185	Homo sapiens	Q14315 (AlphaFold model)
Platelet glycoprotein Ib alpha chain	B	protein	9	Homo sapiens	P07359 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MGX_1 Filamin-C (chains A)
QKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYW
PTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFT
IDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPK
SPFRV

Sequence of entity 2 (B), FASTA

>4MGX_2 Platelet glycoprotein Ib alpha chain (chains B)
PTFRSSLFL

Primary citation

A Novel Structural Unit in the N-terminal Region of Filamins. Sethi, R., Seppala, J., Tossavainen, H. et al. J Biol Chem (2014) 289:8588-8598. DOI 10.1074/jbc.M113.537456 · PubMed

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 4MGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.