Crystal structure of Atg7CTD-Atg8 complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Sept 2011.
Explore 3VH3 in 3D Show helices and sheets RCSB PDB PDBe
3VH3 contains 22 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 295-308 | 14 | |
| α-helix | 309-313 | 5 | |
| α-helix | 319-323 | 5 | |
| β-strand | 326-330 | 5 | 1 |
| α-helix | 334-345 | 12 | |
| β-strand | 350-354 | 5 | 1 |
| β-strand | 358 | 1 | 2 |
| α-helix | 372-374 | 3 | |
| β-strand | 378 | 1 | 2 |
| α-helix | 379-390 | 12 | |
| β-strand | 395-399 | 5 | 1 |
| α-helix | 404-405 | 2 | |
| α-helix | 413-429 | 17 | |
| β-strand | 432-435 | 4 | 1 |
| α-helix | 441-443 | 3 | |
| α-helix | 444-452 | 9 | |
| β-strand | 456-462 | 7 | 1 |
| β-strand | 466-471 | 6 | 1 |
| β-strand | 483 | 1 | 3 |
| α-helix | 512-529 | 18 | |
| α-helix | 532-534 | 3 | |
| β-strand | 539-540 | 2 | 4 |
| β-strand | 543-544 | 2 | 4 |
| β-strand | 548-552 | 5 | 1 |
| β-strand | 557-561 | 5 | 1 |
| β-strand | 564 | 1 | 3 |
| α-helix | 565-566 | 2 | |
| α-helix | 574-583 | 10 | |
| α-helix | 585-593 | 9 | |
| α-helix | 595-602 | 8 | |
| α-helix | 604-612 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 5 |
| β-strand | 48-52 | 5 | 5 |
| β-strand | 56 | 1 | 6 |
| α-helix | 57-67 | 11 | |
| β-strand | 76-79 | 4 | 5 |
| β-strand | 90 | 1 | 6 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-111 | 7 | 5 |
| α-helix | 112-113 | 2 | |
| β-strand | 115 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like modifier-activating enzyme ATG7 | A | protein | 340 | Saccharomyces cerevisiae | P38862 (AlphaFold model) |
| Autophagy-related protein 8 | B | protein | 119 | Saccharomyces cerevisiae | P38182 (AlphaFold model) |
>3VH3_1 Ubiquitin-like modifier-activating enzyme ATG7 (chains A) GPHMLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRK ITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKL VNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVM RHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLL QTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKK ALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA
>3VH3_2 Autophagy-related protein 8 (chains B) GPHMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTV GQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structural basis of Atg8 activation by a homodimeric E1, Atg7. Noda, N.N., Satoo, K., Fujioka, Y. et al. Mol Cell (2011) 44:462-475. DOI 10.1016/j.molcel.2011.08.035 · PubMed
Other PDB entries of the same protein (UniProt P38862 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VH3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.