3VOQ: Target of rapamycin complex 2 subunit MAPKAP1

Crystal structure of the pleckstrin homology domain of human Sin1, a TORC2 subunit. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Apr 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,930
Mol. weight: 28.23 kDa
Released: 11 Apr 2012

Explore 3VOQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VOQ contains 6 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	370-378	9
β-strand	384-392	9	1
β-strand	396-404	9	1
β-strand	408-413	6	1
β-strand	424	1	2
β-strand	430-433	4	1
α-helix	434-436	3
β-strand	437-445	9	1
β-strand	451-459	9	1
β-strand	462-470	9	1
α-helix	472-487	16

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	370-381	12
β-strand	384-393	10	2
β-strand	396-404	9	2
β-strand	408-413	6	2
β-strand	430-433	4	2
α-helix	434-436	3
β-strand	437-447	11	2
β-strand	450-459	10	2
β-strand	462-470	9	2
α-helix	472-487	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Target of rapamycin complex 2 subunit MAPKAP1	A, B	protein	125	Homo sapiens	Q9BPZ7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3VOQ_1 Target of rapamycin complex 2 subunit MAPKAP1 (chains A, B)
GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQK
PISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILES
RASTA

Primary citation

Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2. Pan, D., Matsuura, Y. Acta Crystallogr Sect F Struct Biol Cryst Commun (2012) 68:386-392. DOI 10.1107/S1744309112007178 · PubMed

Other PDB entries of the same protein (UniProt Q9BPZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7VV9 1.6 Å, Crystal Structure of HRas(GMPPNP-bound) in complex with the Ras-binding domain(RBD) of…
7VV8 1.7 Å, Crystal Structure of HRasQ61L(GMPPNP-bound) in complex with the Ras-binding domain(RBD)…
7VVB 1.7 Å, Crystal Structure of KRas4A(GMPPNP-bound) in complex with the Ras-binding domain(RBD) of…
7VVG 1.7 Å, Crystal Structure of HRasG12V(GMPPNP-bound) in complex with the Ras-binding domain(RBD)…
7LC1 2.35 Å, Crystal Structure of KRAS4b (GMPPNP-bound) in complex with the RBD-PH domains of SIN1
9T94 2.6 Å, cryo-EM structure of AKT phosphorylated mTOR complex 2, focused on a single protomer
9ZBK 2.6 Å, mTORC2 in complex with Akt1
7LC2 2.7 Å, Crystal Structure of KRAS4b-Q61R (GMPPNP-bound) in complex with the RAS-binding domain…
9T93 2.86 Å, cryo-EM structure of autophosphorylated mTOR complex 2, focused on a single protomer
6ZWO 3.0 Å, cryo-EM structure of human mTOR complex 2, focused on one half
9T7J 3.0 Å, cryo-EM structure of AKT phosphorylated mTOR complex 2, overall refinement
9TDT 3.0 Å, cryo-EM structure of dephosphorylated mTOR complex 2, focused on a single protomer

Browse structure collections

About this viewer

MolViewer shows 3VOQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.