3VW7: Human protease-activated receptor 1

Crystal structure of human protease-activated receptor 1 (PAR1) bound with antagonist vorapaxar at 2.2 angstrom. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,827
Mol. weight: 58.1 kDa
Ligands: VPX, OLC
Released: 12 Dec 2012

Explore 3VW7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VW7 contains 25 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	92-96	5
α-helix	99	1
α-helix	100-104	5
α-helix	105-130	26
α-helix	131-133	3
α-helix	136-152	17
α-helix	155-163	9
α-helix	172-205	34
α-helix	216-238	23
β-strand	243-246	4	1
β-strand	251-254	4	1
α-helix	265-296	32
α-helix	1003-1011	9
β-strand	1014-1015	2	2
β-strand	1016	1	3
β-strand	1017-1019	3	2
β-strand	1025-1028	4	2
β-strand	1031-1034	4	2
α-helix	1039-1050	12
β-strand	1057	1	3
α-helix	1060-1079	20
α-helix	1085-1088	4
α-helix	1093-1112	20
α-helix	1115-1122	8
α-helix	1126-1133	8
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	1159-303	4
α-helix	305-320	16
α-helix	321-326	6
α-helix	327-338	12
α-helix	347-360	14
α-helix	363-373	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteinase-activated receptor 1, Lysozyme	A	protein	484	Homo sapiens, Enterobacteria phage T4	P00720, P25116 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VW7_1 Proteinase-activated receptor 1, Lysozyme (chains A)
SGTAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYML
HLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFL
AVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLGITTCHDVLSETL
LEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSANIFEMLRIDEGLRLKIYKNTE
GYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNA
KLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQT
PNRAKRVITTFRTGTWDAYANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHT
STTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRYVYSILCCKESSDPSCYHHHHHH
HHHH

Ligands and cofactors

ID	Name	Formula	Copies
VPX	ethyl [(1R,3aR,4aR,6R,8aR,9S,9aS)-9-{(E)-2-[5-(3-fluorophenyl)pyridin-2-yl]ethe…	C29 H33 F N2 O4	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	9

Water and common crystallization additives (NA, CL) are not listed.

Primary citation

High-resolution crystal structure of human protease-activated receptor 1. Zhang, C., Srinivasan, Y., Arlow, D.H. et al. Nature (2012) 492:387-392. DOI 10.1038/nature11701 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse more

3VW7 is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 3VW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.