P453H/I471T mutant of PB2 middle domain from influenza virus A/Puerto Rico/8/34(H1N1) with m7GTP. Determined by X-ray diffraction at 1.93 Å resolution. Released 18 Dec 2013.
Explore 3WI1 in 3D Show helices and sheets RCSB PDB PDBe
3WI1 contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 323-325 | 3 | 1 |
| β-strand | 328-335 | 8 | 1 |
| β-strand | 338-345 | 8 | 2 |
| β-strand | 351-358 | 8 | 2 |
| β-strand | 361-366 | 6 | 1 |
| β-strand | 370-377 | 8 | 1 |
| β-strand | 380-388 | 9 | 1 |
| α-helix | 391-404 | 14 | |
| α-helix | 408-411 | 4 | |
| β-strand | 421 | 1 | 3 |
| α-helix | 426 | 1 | |
| β-strand | 427 | 1 | 3 |
| α-helix | 428-429 | 2 | |
| α-helix | 430-440 | 11 | |
| α-helix | 443-449 | 7 | |
| β-strand | 451-453 | 3 | 4 |
| β-strand | 460-461 | 2 | 1 |
| β-strand | 462-463 | 2 | 5 |
| β-strand | 469-470 | 2 | 5 |
| β-strand | 473-475 | 3 | 4 |
| β-strand | 478-481 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase basic protein 2 | A | protein | 174 | Influenza A virus | P03428 (AlphaFold model) |
>3WI1_1 Polymerase basic protein 2 (chains A) GSHMRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAI LRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQ LLRHFQKDAKVLFQNWGVEHIDNVMGMIGILPDMTPSTEMSMRGVRISKMGSGC
| ID | Name | Formula | Copies |
|---|---|---|---|
| MGT | 7N-methyl-8-hydroguanosine-5'-triphosphate | C11 H20 N5 O14 P3 | 1 |
Conformational Polymorphism of m7GTP in Crystal Structure of the PB2 Middle Domain from Human Influenza A Virus. Tsurumura, T., Qiu, H., Yoshida, T. et al. PLoS One (2013) 8:e82020-e82020. DOI 10.1371/journal.pone.0082020 · PubMed
Other PDB entries of the same protein (UniProt P03428 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.