3WP1: Disks large homolog 4

Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 1,565
Mol. weight: 24.09 kDa
Released: 19 Mar 2014

Explore 3WP1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WP1 contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	0-4	5

Chain B: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	537-540	4	1
α-helix	544-554	11
β-strand	559-560	2	2
β-strand	565-566	2	3
α-helix	569-571	3
β-strand	576	1	4
β-strand	580	1	4
β-strand	581-582	2	3
α-helix	586-594	9
β-strand	598-604	7	3
β-strand	607-612	6	3
α-helix	613-620	8
β-strand	625-626	2	2
β-strand	627-628	2	1
α-helix	633-640	8
β-strand	646-650	5	1
α-helix	655-661	7
α-helix	667-684	18
α-helix	685-687	3
β-strand	690-692	3	1
α-helix	697-710	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	B	protein	187	Rattus norvegicus	P31016 (AlphaFold model)
Lethal(2) giant larvae protein homolog 2	A	protein	17	Homo sapiens	Q6P1M3 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3WP1_1 Disks large homolog 4 (chains B)
GPGSVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSR
EKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPI
AIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKR
VIEDLSG

Sequence of entity 2 (A), FASTA

>3WP1_2 Lethal(2) giant larvae protein homolog 2 (chains A)
LKKSLRQSFRRMRRSRV

Primary citation

Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl. Zhu, J., Shang, Y., Wan, Q. et al. Cell Res (2014) 24:451-463. DOI 10.1038/cr.2014.16 · PubMed

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…

Browse structure collections

About this viewer

MolViewer shows 3WP1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.