3ZRZ: Second and third fibronectin F1 modules

Crystal structure of the second and third fibronectin F1 modules in complex with a fragment of Streptococcus pyogenes SfbI-5. Determined by X-ray diffraction at 1.7 Å resolution. Released 28 Sept 2011.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: HOMO SAPIENS, STREPTOCOCCUS PYOGENES
Chains: 4
Atoms: 1,893
Mol. weight: 24.43 kDa
Released: 28 Sept 2011

Explore 3ZRZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZRZ contains 0 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	65-67	3	1
β-strand	74-76	3	1
β-strand	80-85	6	2
β-strand	88-96	9	2
β-strand	101-105	5	2
β-strand	109-112	4	3
β-strand	115-118	4	3
β-strand	122-126	5	4
β-strand	133-140	8	4
β-strand	145-150	6	4

Chain B: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	5
β-strand	73-76	4	5
β-strand	80-85	6	6
β-strand	88-96	9	6
β-strand	101-105	5	6
β-strand	109-112	4	7
β-strand	115-118	4	7
β-strand	122-126	5	8
β-strand	133-140	8	8
β-strand	145-150	6	8

Chains C and D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	562-565	4	4
β-strand	570-574	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A, B	protein	90	HOMO SAPIENS	P02751 (AlphaFold model)
Fibronectin-binding protein	C, D	protein	20	STREPTOCOCCUS PYOGENES	Q711B0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ZRZ_1 FIBRONECTIN (chains A, B)
AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGD
TWRRPHETGGYMLECVCLGNGKGEWTCKPI

Sequence of entity 2 (C, D), FASTA

>3ZRZ_2 FIBRONECTIN-BINDING PROTEIN (chains C, D)
XTGMSGFSETVTIVEDTRPX

Primary citation

Structural and Functional Analysis of the Tandem Beta-Zipper Interaction of a Streptococcal Protein with Human Fibronectin. Norris, N.C., Bingham, R.J., Harris, G. et al. J Biol Chem (2011) 286:38311. DOI 10.1074/JBC.M111.276592 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
1FNF 2.0 Å, Fragment of human fibronectin encompassing type-III repeats 7 through 10

Browse structure collections

About this viewer

MolViewer shows 3ZRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.