3ZS9: Atpase GET3

S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment. Determined by X-ray diffraction at 2.1 Å resolution. Released 7 Sept 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 4
Atoms: 5,530
Mol. weight: 88.65 kDa
Ligands: ADP, ALF, MG, ZN
Released: 7 Sept 2011

Explore 3ZS9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZS9 contains 36 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-24	5	1
α-helix	31-45	15
β-strand	51-55	5	1
α-helix	62-66	5
β-strand	75-76	2	1
α-helix	77	1
β-strand	83-87	5	1
α-helix	90-99	10
α-helix	130-132	3
α-helix	136-153	18
β-strand	162-166	5	1
α-helix	167-169	3
α-helix	170-186	17
α-helix	214-230	17
β-strand	236-243	8	1
α-helix	246-261	16
β-strand	268-274	7	1
α-helix	286-305	20
β-strand	310-315	6	1
α-helix	316-317	2
α-helix	324-335	12
α-helix	340-343	4
α-helix	344-348	5

Chain B: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-25	6	2
α-helix	31-45	15
β-strand	51-55	5	2
α-helix	62-66	5
β-strand	75-76	2	2
α-helix	77	1
β-strand	83-87	5	2
α-helix	90-99	10
α-helix	130-132	3
α-helix	136-152	17
β-strand	162-166	5	2
α-helix	167-169	3
α-helix	170-196	27
α-helix	213-230	18
β-strand	236-243	8	2
α-helix	246-261	16
β-strand	268-274	7	2
α-helix	286-305	20
β-strand	310-315	6	2
α-helix	316-317	2
α-helix	324-335	12
α-helix	340-343	4
α-helix	344-348	5

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	506-521	16
α-helix	525-533	9

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	506-520	15
α-helix	525-536	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Atpase GET3	A, B	protein	354	SACCHAROMYCES CEREVISIAE	Q12154 (AlphaFold model)
Golgi to er traffic protein 2	C, D	protein	38	SACCHAROMYCES CEREVISIAE	P40056 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ZS9_1 ATPASE GET3 (chains A, B)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE

Sequence of entity 2 (C, D), FASTA

>3ZS9_2 GOLGI TO ER TRAFFIC PROTEIN 2 (chains C, D)
MSELTEAEKRRLLRERRQKKFSNGGASSRLNKITGQAS

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
ALF	Tetrafluoroaluminate ion	Al F4	2
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	1

Primary citation

The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion. Mariappan, M., Mateja, A., Dobosz, M. et al. Nature (2011) 477:61. DOI 10.1038/NATURE10362 · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3H84 2.3 Å, Crystal structure of GET3
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3A37 3.0 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment
9NS5 3.19 Å, Get3(D57N)-Get4/5 Complex (ATP-bound)

Browse structure collections

About this viewer

MolViewer shows 3ZS9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.