4A9Z: Human P63 tetramerization domain

Crystal structure of human P63 tetramerization domain. Determined by X-ray diffraction at 2.29 Å resolution. Released 7 Dec 2011.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,700
Mol. weight: 29.88 kDa
Ligands: PE4
Released: 7 Dec 2011

Explore 4A9Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4A9Z contains 12 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-367	7	1
α-helix	369-384	16
α-helix	385-387	3
α-helix	390-400	11

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-367	7	1
α-helix	369-384	16
α-helix	385-387	3
α-helix	392-400	9

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-367	7	2
α-helix	369-384	16
α-helix	385-387	3
α-helix	390-410	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein 63	A, B, C, D	protein	61	HOMO SAPIENS	Q9H3D4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4A9Z_1 TUMOR PROTEIN 63 (chains A, B, C, D)
GSDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQ
S

Ligands and cofactors

ID	Name	Formula	Copies
PE4	2-{2-[2-(2-{2-[2-(2-ethoxy-ethoxy)-ethoxy]-ethoxy}-ethoxy)-ethoxy]-ethoxy}-etha…	C16 H34 O8	1

Primary citation

Crystal Structure of Human P63 Tetramerization Domain. Muniz, J.R.C., Coutandin, D., Salah, E. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…

Browse structure collections

About this viewer

MolViewer shows 4A9Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.