4ASW: PDB entry 4ASW

Structure of the complex between the N-terminal dimerisation domain of Sgt2 and the UBL domain of Get5. Determined by solution NMR. Released 16 Jan 2013.

Method: Solution NMR
Organism: SACCHAROMYCES CEREVISIAE
Chains: 3
Atoms: 1,821
Mol. weight: 29.46 kDa
Released: 16 Jan 2013

Explore 4ASW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ASW contains 13 α-helices and 7 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	19-35	17
α-helix	41-58	18
α-helix	62-64	3
α-helix	65-71	7
α-helix	79-84	6

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	19-34	16
α-helix	41-58	18
α-helix	62-64	3
α-helix	65-71	7
α-helix	79-85	7

Chain C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	20-26	7	1
β-strand	33-38	6	1
β-strand	43	1	2
α-helix	44-53	10
α-helix	60-62	3
β-strand	63-67	5	1
β-strand	70-72	3	1
β-strand	77	1	2
α-helix	78-80	3
β-strand	89-94	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small glutamine-rich tetratricopeptide repeat-containing protein 2	A, B	protein	92	SACCHAROMYCES CEREVISIAE	Q12118 (AlphaFold model)
Ubiquitin-like protein MDY2	C	protein	83	SACCHAROMYCES CEREVISIAE	Q12285 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ASW_1 SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PROTEIN 2 (chains A, B)
MAHHHHHHVDDDDMMSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF
EREAVSGILGKSEFKGQHLADILNSASRVPES

Sequence of entity 2 (C), FASTA

>4ASW_2 UBIQUITIN-LIKE PROTEIN MDY2 (chains C)
DNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDN
LFLSDLKVTPANSTITVMIKPNP

Primary citation

Structure of the Sgt2/Get5 Complex Provides Insights Into Get-Mediated Targeting of Tail-Anchored Membrane Proteins. Simon, A.C., Simpson, P.J., Goldstone, R.M. et al. Proc Natl Acad Sci U S A (2013) 110:1327. DOI 10.1073/PNAS.1207518110 · PubMed

Other PDB entries of the same protein (UniProt Q12118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LYP 1.55 Å, Crystal structure of the Tpr Domain of Sgt2.
3ZDM 1.8 Å, Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
5LYN 2.0 Å, Structure of the Tpr Domain of Sgt2 in complex with yeast Ssa1 peptide fragment
2LXB Solution structure of the Sgt2 homodimerization domain
2LXC Solution structure of the complex between the Sgt2 homodimerization domain and the Get5…
4ASV Solution structure of the N-terminal dimerisation domain of Sgt2
9LLV Dimer Sgt2 from S.cerevisiae

Browse structure collections

About this viewer

MolViewer shows 4ASW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.