4BL0: Yeast Bub3-Bub1
Crystal structure of yeast Bub3-Bub1 bound to phospho-Spc105. Determined by X-ray diffraction at 1.95 Å resolution. Released 18 Sept 2013.
- Method
- X-ray diffraction
- Resolution
- 1.95 Å
- Organism
- SACCHAROMYCES CEREVISIAE
- Chains
- 6
- Atoms
- 6,408
- Mol. weight
- 99.28 kDa
- Ligands
- MG
- Released
- 18 Sept 2013
Explore 4BL0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4BL0 contains 19 α-helices and 77 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 34 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-5 | 4 | 1 |
| α-helix | 13 | 1 | |
| β-strand | 14-20 | 7 | 2 |
| β-strand | 25-30 | 6 | 2 |
| β-strand | 34-41 | 8 | 2 |
| β-strand | 46-54 | 9 | 2 |
| β-strand | 55 | 1 | 3 |
| β-strand | 59-66 | 8 | 4 |
| β-strand | 70-76 | 7 | 4 |
| β-strand | 81-84 | 4 | 4 |
| β-strand | 92-94 | 3 | 4 |
| α-helix | 95 | 1 | |
| β-strand | 96 | 1 | 5 |
| β-strand | 104-110 | 7 | 6 |
| β-strand | 114-119 | 6 | 6 |
| β-strand | 123-127 | 5 | 6 |
| α-helix | 129-132 | 4 | |
| β-strand | 135 | 1 | 5 |
| β-strand | 136-141 | 6 | 6 |
| β-strand | 153-158 | 6 | 7 |
| β-strand | 162-167 | 6 | 7 |
| β-strand | 171-176 | 6 | 7 |
| β-strand | 186-189 | 4 | 7 |
| β-strand | 196-201 | 6 | 8 |
| α-helix | 202-203 | 2 | |
| β-strand | 208-213 | 6 | 8 |
| β-strand | 217-222 | 6 | 8 |
| β-strand | 236-239 | 4 | 8 |
| β-strand | 242-244 | 3 | 9 |
| β-strand | 249-251 | 3 | 9 |
| β-strand | 254-259 | 6 | 10 |
| β-strand | 266-270 | 5 | 10 |
| β-strand | 275-279 | 5 | 10 |
| β-strand | 284-288 | 5 | 10 |
| α-helix | 289-291 | 3 | |
| β-strand | 296-302 | 7 | 1 |
| β-strand | 306-312 | 7 | 1 |
| α-helix | 315-318 | 4 | |
| β-strand | 327-328 | 2 | 11 |
| α-helix | 329-331 | 3 | |
| β-strand | 332-337 | 6 | 1 |
Chains B and E: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 307-309 | 3 | 9 |
| β-strand | 317-319 | 3 | 9 |
| α-helix | 323-326 | 4 | |
| α-helix | 336-343 | 8 | |
Chain C: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 168 | 1 | 10 |
| β-strand | 170-172 | 3 | 8 |
Chain D: 8 helices, 34 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-5 | 4 | 12 |
| α-helix | 13 | 1 | |
| β-strand | 14-20 | 7 | 11 |
| α-helix | 21-23 | 3 | |
| β-strand | 25-30 | 6 | 11 |
| β-strand | 34-41 | 8 | 11 |
| β-strand | 46-55 | 10 | 11 |
| β-strand | 59-66 | 8 | 13 |
| β-strand | 70-76 | 7 | 13 |
| β-strand | 81-84 | 4 | 13 |
| β-strand | 92-94 | 3 | 13 |
| α-helix | 95 | 1 | |
| β-strand | 96 | 1 | 14 |
| β-strand | 104-110 | 7 | 15 |
| β-strand | 114-119 | 6 | 15 |
| β-strand | 123-127 | 5 | 15 |
| α-helix | 129-132 | 4 | |
| β-strand | 135 | 1 | 14 |
| β-strand | 136-141 | 6 | 15 |
| β-strand | 153-158 | 6 | 16 |
| β-strand | 162-167 | 6 | 16 |
| β-strand | 171-176 | 6 | 16 |
| β-strand | 186-189 | 4 | 16 |
| β-strand | 191 | 1 | 17 |
| β-strand | 196-201 | 6 | 18 |
| α-helix | 202-203 | 2 | |
| β-strand | 208-213 | 6 | 18 |
| β-strand | 217-222 | 6 | 18 |
| β-strand | 236-239 | 4 | 18 |
| β-strand | 242-244 | 3 | 19 |
| β-strand | 249-251 | 3 | 19 |
| β-strand | 254-259 | 6 | 20 |
| β-strand | 266-270 | 5 | 20 |
| β-strand | 275-279 | 5 | 20 |
| β-strand | 284-288 | 5 | 20 |
| α-helix | 289-291 | 3 | |
| β-strand | 296-302 | 7 | 12 |
| β-strand | 306-312 | 7 | 12 |
| α-helix | 315-318 | 4 | |
| β-strand | 327 | 1 | 3 |
| α-helix | 329-331 | 3 | |
| β-strand | 332-337 | 6 | 12 |
Chain F: 0 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 168 | 1 | 20 |
| β-strand | 170-172 | 3 | 18 |
| β-strand | 175 | 1 | 17 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cell cycle arrest protein BUB3 | A, D | protein | 341 | SACCHAROMYCES CEREVISIAE | P26449 (AlphaFold model) |
| Checkpoint serine/threonine-protein kinase BUB1 | B, E | protein | 75 | SACCHAROMYCES CEREVISIAE | P41695 (AlphaFold model) |
| Spindle pole body component SPC105 | C, F | protein | 19 | SACCHAROMYCES CEREVISIAE | P53148 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>4BL0_1 CELL CYCLE ARREST PROTEIN BUB3 (chains A, D)
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN
Sequence of entity 2 (B, E), FASTA
>4BL0_2 CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1 (chains B, E)
PLGSNKKTSIYADQKQSNNPVYKLINTPGRKPERIVFNFNLIYPENDEEFNTEEILAMIK
GLYKVQRRGKKHTED
Sequence of entity 3 (C, F), FASTA
>4BL0_3 SPINDLE POLE BODY COMPONENT SPC105 (chains C, F)
DPTSMEMTEVFPRSIRQKN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 2 |
Primary citation
Bub3 Reads Phosphorylated Melt Repeats to Promote Spindle Assembly Checkpoint Signaling. Primorac, I., Weir, J.R., Chiroli, E. et al. Elife (2013) 2:01030. DOI 10.7554/ELIFE.01030 · PubMed
Other PDB entries of the same protein (UniProt P26449 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1YFQ 1.1 Å, High resolution S. cerevisiae Bub3 mitotic checkpoint protein
- 2I3S 1.9 Å, Bub3 complex with Bub1 GLEBS motif
- 1U4C 2.35 Å, Structure of spindle checkpoint protein Bub3
- 2I3T 2.8 Å, Bub3 complex with Mad3 (BubR1) GLEBS motif
Browse structure collections
About this viewer
MolViewer shows 4BL0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.