4CLN: Calmodulin

Structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-Å resolution. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Jul 1992.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 1,246
Mol. weight: 16.85 kDa
Ligands: CA
Released: 15 Jul 1992

Explore 4CLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CLN contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	26-27	2	1
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	1
α-helix	65-92	28
α-helix	102-112	11
α-helix	118-126	9
α-helix	138-144	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	148	Drosophila melanogaster	P62152 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4CLN_1 CALMODULIN (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEE
VDEMIREADIDGDGQVNYEEFVTMMTSK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structure of a recombinant calmodulin from Drosophila melanogaster refined at 2.2-A resolution. Taylor, D.A., Sack, J.S., Maune, J.F. et al. J Biol Chem (1991) 266:21375-21380. PubMed

Other PDB entries of the same protein (UniProt P62152 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MXE 1.7 Å, Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
7CQH 2.15 Å, Complex of TRP_CBS2 and Calmodulin_Clobe
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
8ZLW 2.2 Å, Crystal Structure of RDGC IQ motif/dCaM Complex
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4PJJ 2.4 Å, MYOSIN VI (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state - long soaking with PO4
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm

Browse structure collections

About this viewer

MolViewer shows 4CLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.