Crystal Structure of the ankyrin-B ZU5-ZU5-UPA-DD tandem. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Mar 2012.
Explore 4D8O in 3D Show helices and sheets RCSB PDB PDBe
4D8O contains 18 α-helices and 39 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 965 | 1 | 1 |
| β-strand | 970-974 | 5 | 2 |
| β-strand | 979-982 | 4 | 3 |
| β-strand | 990-993 | 4 | 3 |
| β-strand | 1002-1008 | 7 | 2 |
| β-strand | 1009 | 1 | 1 |
| α-helix | 1017-1019 | 3 | |
| β-strand | 1025-1026 | 2 | 2 |
| β-strand | 1031-1034 | 4 | 2 |
| β-strand | 1039-1049 | 11 | 3 |
| β-strand | 1052 | 1 | 4 |
| β-strand | 1059-1066 | 8 | 2 |
| β-strand | 1073-1074 | 2 | 2 |
| α-helix | 1095-1097 | 3 | |
| α-helix | 1098-1104 | 7 | |
| β-strand | 1106-1113 | 8 | 3 |
| β-strand | 1117-1124 | 8 | 2 |
| β-strand | 1126-1131 | 6 | 5 |
| β-strand | 1132 | 1 | 6 |
| β-strand | 1135 | 1 | 6 |
| β-strand | 1136-1139 | 4 | 7 |
| β-strand | 1147-1150 | 4 | 7 |
| β-strand | 1159-1166 | 8 | 5 |
| α-helix | 1170-1177 | 8 | |
| β-strand | 1181-1183 | 3 | 5 |
| β-strand | 1186-1190 | 5 | 5 |
| β-strand | 1195-1205 | 11 | 7 |
| α-helix | 1206-1207 | 2 | |
| β-strand | 1225-1230 | 6 | 5 |
| α-helix | 1237-1238 | 2 | |
| β-strand | 1241-1242 | 2 | 5 |
| α-helix | 1244-1246 | 3 | |
| β-strand | 1250-1252 | 3 | 7 |
| β-strand | 1255-1262 | 8 | 7 |
| β-strand | 1265-1271 | 7 | 5 |
| α-helix | 1274-1276 | 3 | |
| α-helix | 1277-1288 | 12 | |
| α-helix | 1291 | 1 | |
| β-strand | 1292-1295 | 4 | 4 |
| β-strand | 1296-1302 | 7 | 8 |
| β-strand | 1308-1316 | 9 | 8 |
| α-helix | 1324-1326 | 3 | |
| β-strand | 1332-1336 | 5 | 8 |
| β-strand | 1340-1343 | 4 | 4 |
| β-strand | 1347-1354 | 8 | 9 |
| β-strand | 1356-1358 | 3 | 8 |
| β-strand | 1366-1369 | 4 | 9 |
| β-strand | 1377-1384 | 8 | 8 |
| β-strand | 1392-1398 | 7 | 9 |
| β-strand | 1413-1418 | 6 | 9 |
| α-helix | 1453-1462 | 10 | |
| α-helix | 1465-1472 | 8 | |
| α-helix | 1477-1486 | 10 | |
| α-helix | 1491-1506 | 16 | |
| α-helix | 1507-1509 | 3 | |
| α-helix | 1512-1521 | 10 | |
| α-helix | 1525-1528 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ankyrin-2 | A | protein | 581 | Homo sapiens | Q01484 (AlphaFold model) |
>4D8O_1 Ankyrin-2 (chains A) MHHHHHHSSGLEVLFQGPEFSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVT CRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLR SENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIK QDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSP IVTLEPRRRKFHKPITMTIPVPKASGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNE CVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCF CMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFK ENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEE EIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQ SHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNT
Structure of the ZU5-ZU5-UPA-DD tandem of ankyrin-B reveals interaction surfaces necessary for ankyrin function. Wang, C., Yu, C., Ye, F. et al. Proc Natl Acad Sci U S A (2012) 109:4822-4827. DOI 10.1073/pnas.1200613109 · PubMed
Other PDB entries of the same protein (UniProt Q01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4D8O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.