6M3Q: AnkB/beta4-spectrin complex

Crystal structure of AnkB/beta4-spectrin complex. Determined by X-ray diffraction at 3.44 Å resolution. Released 13 May 2020.

Method: X-ray diffraction
Resolution: 3.44 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 5,445
Mol. weight: 90.11 kDa
Released: 13 May 2020

Explore 6M3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M3Q contains 25 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 16 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	964-968	5	1
β-strand	971-974	4	2
β-strand	979-983	5	1
β-strand	990-993	4	1
α-helix	994	1
β-strand	1002-1009	8	2
α-helix	1016-1019	4
β-strand	1025-1026	2	2
α-helix	1029	1
β-strand	1030-1034	5	2
β-strand	1039-1082	11	1
β-strand	1085	1	3
β-strand	1092-1099	8	2
β-strand	1106-1107	2	2
α-helix	1114-1121	8
α-helix	1131-1137	7
β-strand	1139-1146	8	1
β-strand	1150-1157	8	2
β-strand	1159-1164	6	4
β-strand	1165	1	5
β-strand	1168	1	5
β-strand	1169-1172	4	6
β-strand	1180-1183	4	6
β-strand	1192-1199	8	4
α-helix	1203-1210	8
β-strand	1216	1	4
α-helix	1218	1
β-strand	1219-1222	4	4
β-strand	1228-1238	11	6
α-helix	1239-1241	3
β-strand	1259-1263	5	4
α-helix	1270-1271	2
β-strand	1274-1275	2	4
β-strand	1283-1285	3	6
β-strand	1288-1295	8	6
β-strand	1298-1302	5	4
α-helix	1307-1309	3
α-helix	1310-1321	12
α-helix	1324	1
β-strand	1325-1328	4	3
β-strand	1329-1335	7	7
β-strand	1341-1349	9	7
α-helix	1357-1361	5
β-strand	1365-1369	5	7
α-helix	1370-1372	3
β-strand	1373-1376	4	3
β-strand	1380-1385	6	8
β-strand	1389-1391	3	7
β-strand	1400-1402	3	8
β-strand	1410-1417	8	7
β-strand	1425-1431	7	8
α-helix	1440-1442	3
β-strand	1446-1451	6	8
α-helix	1452-1456	5

Chain F: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1585-1607	23
α-helix	1616-1635	20
α-helix	1637-1650	14
α-helix	1658-1713	56
α-helix	1722-1760	39
α-helix	1765-1815	51
α-helix	1816-1819	4
α-helix	1834-1867	34
α-helix	1870-1896	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin-2	E	protein	475	Homo sapiens	Q01484 (AlphaFold model)
Spectrin beta chain	F	protein	322	Mus musculus	E9PX29 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>6M3Q_1 Ankyrin-2 (chains E)
TENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVK
RHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGD
SWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNL
IGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLE
PRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLT
FVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEAR
LRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSF
FAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKE

Sequence of entity 2 (F), FASTA

>6M3Q_2 Spectrin beta chain (chains F)
AFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQ
LSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDEL
EHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGH
TAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPR
LTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQE
VLQGWKELLAACEDARLHVSST

Primary citation

Structural Basis Underlying Strong Interactions between Ankyrins and Spectrins. Li, J., Chen, K., Zhu, R. et al. J Mol Biol (2020) 432:3838-3850. DOI 10.1016/j.jmb.2020.04.023 · PubMed

Other PDB entries of the same protein (UniProt Q01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZJ 1.5 Å, Crystal structure of Ankyrin B/NdeL1 complex
5Y4F 1.95 Å, Crystal Structure of AnkB Ankyrin Repeats R13-24 in complex with autoinhibition segment…
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
4D8O 2.2 Å, Crystal Structure of the ankyrin-B ZU5-ZU5-UPA-DD tandem
5Y4E 2.34 Å, Crystal Structure of AnkB Ankyrin Repeats R8-14 in complex with autoinhibition segment…
4RLY 2.5 Å, Crystal Structure of AnkB Ankyrin Repeats (R1-R9) in Complex with Nav1.2 Ankyrin Binding…
5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex
5Y4D 3.3 Å, Crystal Structure of AnkB Ankyrin Repeats in Complex with AnkR/AnkB Chimeric…
4RLV 3.49 Å, Crystal Structure of AnkB 24 Ankyrin Repeats in Complex with AnkR Autoinhibition Segment

Browse structure collections

About this viewer

MolViewer shows 6M3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.