4FI9: Human SUN-KASH complex

Structure of human SUN-KASH complex. Determined by X-ray diffraction at 3.05 Å resolution. Released 18 Jul 2012.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,605
Mol. weight: 23.58 kDa
Released: 18 Jul 2012

Explore 4FI9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FI9 contains 5 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	525-539	15
β-strand	557-558	2	1
β-strand	566	1	2
β-strand	572-576	5	3
β-strand	579-583	5	3
α-helix	588-592	5
β-strand	602-605	4	2
β-strand	609-627	19	1
α-helix	631-633	3
α-helix	635-637	3
β-strand	643	1	4
β-strand	645-651	7	1
β-strand	660-666	7	1
β-strand	674-678	5	1
β-strand	687-694	8	1
β-strand	697	1	4
β-strand	703-706	4	2
β-strand	708-715	8	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6875-6878	4	3
α-helix	6882-6884	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 2	A	protein	195	Homo sapiens	Q9UH99 (AlphaFold model)
Nesprin-2	B	protein	14	Homo sapiens	Q8WXH0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4FI9_1 SUN domain-containing protein 2 (chains A)
VTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLSLFGIPLW
YHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSA
PKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPE
YTCIYRFRVHGEPAH

Sequence of entity 2 (B), FASTA

>4FI9_2 Nesprin-2 (chains B)
FYPMLRYTNGPPPT

Primary citation

Structural insights into SUN-KASH complexes across the nuclear envelope. Wang, W., Shi, Z., Jiao, S. et al. Cell Res (2012) 22:1440-1452. DOI 10.1038/cr.2012.126 · PubMed

Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WMD 1.5 Å, Human Sun2-KASH4 complex
6WME 1.53 Å, Human Sun2-KASH3 complex
6WMG 1.9 Å, Human Sun2 (500-717)
4DXT 2.22 Å, Human SUN2 (AA 522-717)
4DXR 2.32 Å, Human SUN2-KASH1 complex
3UNP 2.39 Å, Structure of human SUN2 SUN domain
6WMF 2.6 Å, Human Sun2-KASH5 complex
4DXS 2.71 Å, Human SUN2-KASH2 complex

Browse structure collections

About this viewer

MolViewer shows 4FI9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.