4DXS: Human SUN2-KASH2 complex

Human SUN2-KASH2 complex. Determined by X-ray diffraction at 2.71 Å resolution. Released 6 Jun 2012.

Method: X-ray diffraction
Resolution: 2.71 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,813
Mol. weight: 26.7 kDa
Ligands: DMU
Released: 6 Jun 2012

Explore 4DXS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DXS contains 9 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	525-540	16
α-helix	552-554	3
β-strand	557-560	4	1
β-strand	566	1	2
β-strand	572-576	5	3
β-strand	579-584	6	3
α-helix	588-592	5
β-strand	602-605	4	2
β-strand	609-627	19	1
α-helix	631-633	3
α-helix	635-637	3
β-strand	643	1	4
β-strand	645-651	7	1
α-helix	658-659	2
β-strand	660-666	7	1
β-strand	674-678	5	1
α-helix	679	1
β-strand	687-694	8	1
β-strand	697	1	4
β-strand	703-706	4	2
β-strand	708-715	8	1
α-helix	716	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6875-6878	4	3
α-helix	6882-6884	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 2	A	protein	202	Homo sapiens	Q9UH99 (AlphaFold model)
Nesprin-2	B	protein	35	Homo sapiens	Q8WXH0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DXS_1 SUN domain-containing protein 2 (chains A)
GPGGSGGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLS
LFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSP
NSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRIL
TNWGHPEYTCIYRFRVHGEPAH

Sequence of entity 2 (B), FASTA

>4DXS_2 Nesprin-2 (chains B)
GPGGSGEEDYSCTQANNFARSFYPMLRYTNGPPPT

Ligands and cofactors

ID	Name	Formula	Copies
DMU	Decyl-beta-D-maltopyranoside	C22 H42 O11	1

Water and common crystallization additives (K) are not listed.

Primary citation

LINC Complexes Form by Binding of Three KASH Peptides to Domain Interfaces of Trimeric SUN Proteins. Sosa, B.A., Rothballer, A., Kutay, U. et al. Cell (2012) 149:1035-1047. DOI 10.1016/j.cell.2012.03.046 · PubMed

Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WMD 1.5 Å, Human Sun2-KASH4 complex
6WME 1.53 Å, Human Sun2-KASH3 complex
6WMG 1.9 Å, Human Sun2 (500-717)
4DXT 2.22 Å, Human SUN2 (AA 522-717)
4DXR 2.32 Å, Human SUN2-KASH1 complex
3UNP 2.39 Å, Structure of human SUN2 SUN domain
6WMF 2.6 Å, Human Sun2-KASH5 complex
4FI9 3.05 Å, Structure of human SUN-KASH complex

Browse structure collections

About this viewer

MolViewer shows 4DXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.