6WMG: Human Sun2

Human Sun2 (500-717). Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,671
Mol. weight: 24.68 kDa
Released: 2 Dec 2020

Explore 6WMG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WMG contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	525-540	16
α-helix	552-554	3
β-strand	557-558	2	1
α-helix	560-562	3
α-helix	564-565	2
β-strand	566	1	2
α-helix	571-576	6
α-helix	588-592	5
β-strand	602-605	4	2
β-strand	609-619	11	1
β-strand	620-627	8	3
α-helix	631-633	3
α-helix	635-637	3
β-strand	643	1	4
β-strand	645-651	7	1
β-strand	660-666	7	1
β-strand	674-678	5	3
α-helix	679	1
β-strand	687-694	8	1
β-strand	697	1	4
β-strand	703-706	4	2
β-strand	708-714	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 2	A	protein	224	Homo sapiens	Q9UH99 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WMG_1 SUN domain-containing protein 2 (chains A)
GPGGSGQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALES
GGASVISTRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVV
RLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEP
IQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH

Primary citation

Structural Analysis of Different LINC Complexes Reveals Distinct Binding Modes. Cruz, V.E., Esra Demircioglu, F., Schwartz, T.U. J Mol Biol (2020) 432:6028-6041. DOI 10.1016/j.jmb.2020.09.019 · PubMed

Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WMD 1.5 Å, Human Sun2-KASH4 complex
6WME 1.53 Å, Human Sun2-KASH3 complex
4DXT 2.22 Å, Human SUN2 (AA 522-717)
4DXR 2.32 Å, Human SUN2-KASH1 complex
3UNP 2.39 Å, Structure of human SUN2 SUN domain
6WMF 2.6 Å, Human Sun2-KASH5 complex
4DXS 2.71 Å, Human SUN2-KASH2 complex
4FI9 3.05 Å, Structure of human SUN-KASH complex

Browse structure collections

About this viewer

MolViewer shows 6WMG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.