6WMF: Human Sun2-KASH5 complex

Human Sun2-KASH5 complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,595
Mol. weight: 25.16 kDa
Released: 2 Dec 2020

Explore 6WMF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WMF contains 5 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	525-540	16
β-strand	557-558	2	1
α-helix	560-562	3
β-strand	566	1	2
β-strand	572-574	3	3
β-strand	582-584	3	3
α-helix	588-592	5
β-strand	602-605	4	2
β-strand	609-627	19	1
α-helix	635-637	3
β-strand	643	1	4
β-strand	645-651	7	1
β-strand	660-666	7	1
β-strand	674-678	5	1
β-strand	687-694	8	1
β-strand	697	1	4
β-strand	703-706	4	2
β-strand	708-715	8	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	789-791	3	3
α-helix	794-796	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 2	A	protein	202	Homo sapiens	Q9UH99 (AlphaFold model)
Protein KASH5	B	protein	27	Homo sapiens	Q8N6L0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WMF_1 SUN domain-containing protein 2 (chains A)
GPGGSGGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVISTRCSETYETKTALLS
LFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSP
NSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMGTYQVVELRIL
TNWGHPEYTCIYRFRVHGEPAH

Sequence of entity 2 (B), FASTA

>6WMF_2 Protein KASH5 (chains B)
GPGGSGGPSPPPTWPHLQLCYLQPPPV

Primary citation

Structural Analysis of Different LINC Complexes Reveals Distinct Binding Modes. Cruz, V.E., Esra Demircioglu, F., Schwartz, T.U. J Mol Biol (2020) 432:6028-6041. DOI 10.1016/j.jmb.2020.09.019 · PubMed

Other PDB entries of the same protein (UniProt Q9UH99 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WMD 1.5 Å, Human Sun2-KASH4 complex
6WME 1.53 Å, Human Sun2-KASH3 complex
6WMG 1.9 Å, Human Sun2 (500-717)
4DXT 2.22 Å, Human SUN2 (AA 522-717)
4DXR 2.32 Å, Human SUN2-KASH1 complex
3UNP 2.39 Å, Structure of human SUN2 SUN domain
4DXS 2.71 Å, Human SUN2-KASH2 complex
4FI9 3.05 Å, Structure of human SUN-KASH complex

Browse structure collections

About this viewer

MolViewer shows 6WMF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.