4E44: HMHF1/hMHF2 Histone-Fold Tetramer

Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Mar 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,783
Mol. weight: 44.32 kDa
Released: 20 Mar 2013

Explore 4E44 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4E44 contains 14 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1-38	38
β-strand	41-42	2	1
α-helix	44-71	28
β-strand	76-77	2	2
α-helix	79-85	7
α-helix	90-100	11

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	12-20	9
β-strand	29-30	2	2
α-helix	32-59	28
β-strand	64-65	2	1
α-helix	67-80	14

Chain C: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	15-38	24
β-strand	42	1	3
α-helix	44-71	28
β-strand	76-77	2	4
α-helix	79-85	7
α-helix	90-104	15

Chain D: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	12-20	9
β-strand	29-30	2	4
α-helix	32-59	28
β-strand	65	1	3
α-helix	67-80	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centromere protein S	A, C	protein	112	Homo sapiens	Q8N2Z9 (AlphaFold model)
Centromere protein X	B, D	protein	83	Homo sapiens	A8MT69 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4E44_1 Centromere protein S (chains A, C)
GSMEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQC
ENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLER

Sequence of entity 2 (B, D), FASTA

>4E44_2 Centromere protein X (chains B, D)
GSMEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQ
AEDALRVDVDQLEKVLPQLLLDF

Primary citation

Crystal Structures Reveal that FANCM remodels the MHF Tetramer in favor of binding Branched DNA. Fox III, D., Yan, Z., Ling, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q8N2Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NE3 1.8 Å, Human MHF1-MHF2 complex
4E45 2.0 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi…
4NE6 2.1 Å, Human MHF1-MHF2 complex
4DRA 2.41 Å, Crystal structure of MHF complex
4NE5 2.5 Å, Human MHF1-MHF2 complex
4DRB 2.63 Å, The crystal structure of FANCM bound MHF complex
28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
7R5S 2.83 Å, Structure of the human CCAN bound to alpha satellite DNA
7XHO 3.29 Å, Structure of human inner kinetochore CCAN complex
9TAW 3.54 Å, Structure of the human inner kinetochore CCAN bound to DNA
7XHN 3.71 Å, Structure of human inner kinetochore CCAN-DNA complex
9TAX 4.5 Å, Structure of the human inner kinetochore CCAN bound to a mono-CENP-A nucleosome

Browse structure collections

About this viewer

MolViewer shows 4E44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.