4EO7: PDB entry 4EO7

Crystal structure of the TIR domain of human myeloid differentiation primary response protein 88. Determined by X-ray diffraction at 1.45 Å resolution. Released 10 Apr 2013.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,456
Mol. weight: 16.8 kDa
Ligands: MG
Released: 10 Apr 2013

Explore 4EO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EO7 contains 15 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	156-158	3
β-strand	161-166	6	1
α-helix	169-171	3
α-helix	172-183	12
β-strand	191-193	3	1
α-helix	196-198	3
β-strand	205-206	2	1
α-helix	209-211	3
α-helix	212-215	4
β-strand	216-223	8	1
α-helix	227-229	3
α-helix	231-242	12
α-helix	244	1
α-helix	247-251	5
β-strand	252-256	5	1
α-helix	263-265	3
α-helix	266-268	3
α-helix	272-273	2
β-strand	274-275	2	1
α-helix	279-281	3
α-helix	285-294	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid differentiation primary response protein MyD88	A	protein	144	Homo sapiens	Q99836 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4EO7_1 Myeloid differentiation primary response protein MyD88 (chains A)
GGVDMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELI
EKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFIT
VCDYTNPCTKSWFWTRLAKALSLP

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Molecular mechanisms for the subversion of MyD88 signaling by TcpC from virulent uropathogenic Escherichia coli. Snyder, G.A., Cirl, C., Jiang, J. et al. Proc Natl Acad Sci U S A (2013) 110:6985-6990. DOI 10.1073/pnas.1215770110 · PubMed

Other PDB entries of the same protein (UniProt Q99836 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
4DOM 1.8 Å, Crystal Structure of the TIR-domain of Human Myeloid Differentiation Primary Response…
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain
7BER 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly (solved, rebuilt and refined…
7L6W 2.3 Å, SFX structure of the MyD88 TIR domain higher-order assembly
8S78 2.85 Å, MicroED Structure of TLR2 TIR domain-induced MyD88 TIR domain higher-order assembly
7BEQ 3.0 Å, MicroED structure of the MyD88 TIR domain higher-order assembly
6I3N 3.1 Å, Helical MyD88 death domain filament
8W8M 3.28 Å, Cryo-EM structure of helical filament of MyD88 TIR
8YYM 3.3 Å, Cryo-EM structure of cylindrical fiber of MyD88 TIR
3MOP 3.4 Å, The ternary Death Domain complex of MyD88, IRAK4, and IRAK2
2JS7 Solution NMR structure of human myeloid differentiation primary response (MyD88).…

Browse structure collections

About this viewer

MolViewer shows 4EO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.